BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_A12 (274 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF045645-1|AAC02605.1| 301|Caenorhabditis elegans Hypothetical ... 74 1e-14 AF003390-4|AAB54273.1| 1165|Caenorhabditis elegans Hypothetical ... 29 0.59 Z68108-19|CAD44153.1| 1895|Caenorhabditis elegans Hypothetical p... 26 3.2 Z68108-18|CAB60299.4| 1868|Caenorhabditis elegans Hypothetical p... 26 3.2 Z68108-17|CAB60298.3| 1898|Caenorhabditis elegans Hypothetical p... 26 3.2 Z50740-6|CAD44124.1| 1895|Caenorhabditis elegans Hypothetical pr... 26 3.2 Z50740-5|CAB60282.4| 1868|Caenorhabditis elegans Hypothetical pr... 26 3.2 Z50740-4|CAB60281.3| 1898|Caenorhabditis elegans Hypothetical pr... 26 3.2 U41279-6|AAK31423.1| 321|Caenorhabditis elegans Helix loop heli... 26 3.2 AF044576-1|AAC38963.1| 1898|Caenorhabditis elegans phospholipase... 26 3.2 U41279-4|AAK31421.1| 313|Caenorhabditis elegans Helix loop heli... 26 4.2 U13019-7|AAC24445.2| 689|Caenorhabditis elegans Hypothetical pr... 25 7.3 AC084197-18|AAM44394.1| 546|Caenorhabditis elegans Hypothetical... 25 7.3 Z92831-2|CAB07368.2| 861|Caenorhabditis elegans Hypothetical pr... 25 9.7 Z81534-7|CAN86914.1| 3653|Caenorhabditis elegans Hypothetical pr... 25 9.7 Z81534-6|CAN86913.1| 3719|Caenorhabditis elegans Hypothetical pr... 25 9.7 Z75525-1|CAA99766.1| 262|Caenorhabditis elegans Hypothetical pr... 25 9.7 Z49130-10|CAD59157.2| 3653|Caenorhabditis elegans Hypothetical p... 25 9.7 Z49130-9|CAA88964.2| 3719|Caenorhabditis elegans Hypothetical pr... 25 9.7 AL032667-2|CAN86634.1| 3653|Caenorhabditis elegans Hypothetical ... 25 9.7 AL032667-1|CAN86633.1| 3719|Caenorhabditis elegans Hypothetical ... 25 9.7 >AF045645-1|AAC02605.1| 301|Caenorhabditis elegans Hypothetical protein K02D7.1 protein. Length = 301 Score = 74.1 bits (174), Expect = 1e-14 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 1/70 (1%) Frame = +2 Query: 53 LVFGRIEGVHVVVMRGRFHYYE-GYPLWKC*LPVRVMKLLGVHTLIATNADGGLNSNYKI 229 ++FG++ G VV ++GRFH YE L C LPVRVM LG+ +I +NA GG+N+ + Sbjct: 86 MIFGKLGGKKVVCLQGRFHPYEHNMDLALCTLPVRVMHQLGIKIMIVSNAAGGINAVLRH 145 Query: 230 GDLMIVKDHI 259 GDLM++KDHI Sbjct: 146 GDLMLIKDHI 155 >AF003390-4|AAB54273.1| 1165|Caenorhabditis elegans Hypothetical protein R155.3 protein. Length = 1165 Score = 28.7 bits (61), Expect = 0.59 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = -1 Query: 274 EAHHINMVLNNHQVANL--IVGIQSTVRVRSNQCMYSEKFHHPNRESALPKWVTFVI 110 E + LN+ VANL + GI+ ++ S + + +K P ++LP + TF + Sbjct: 492 EVEKVKDQLNDENVANLKALAGIEGQLKTASGEIVGYKKSVKPVTSTSLPDYSTFFL 548 >Z68108-19|CAD44153.1| 1895|Caenorhabditis elegans Hypothetical protein F31B12.1c protein. Length = 1895 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 148 RESALPKWVTFVIVESTSHDD 86 R S + W+T VIV +HDD Sbjct: 116 RLSEVSSWITHVIVSQPTHDD 136 >Z68108-18|CAB60299.4| 1868|Caenorhabditis elegans Hypothetical protein F31B12.1b protein. Length = 1868 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 148 RESALPKWVTFVIVESTSHDD 86 R S + W+T VIV +HDD Sbjct: 116 RLSEVSSWITHVIVSQPTHDD 136 >Z68108-17|CAB60298.3| 1898|Caenorhabditis elegans Hypothetical protein F31B12.1a protein. Length = 1898 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 148 RESALPKWVTFVIVESTSHDD 86 R S + W+T VIV +HDD Sbjct: 116 RLSEVSSWITHVIVSQPTHDD 136 >Z50740-6|CAD44124.1| 1895|Caenorhabditis elegans Hypothetical protein F31B12.1c protein. Length = 1895 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 148 RESALPKWVTFVIVESTSHDD 86 R S + W+T VIV +HDD Sbjct: 116 RLSEVSSWITHVIVSQPTHDD 136 >Z50740-5|CAB60282.4| 1868|Caenorhabditis elegans Hypothetical protein F31B12.1b protein. Length = 1868 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 148 RESALPKWVTFVIVESTSHDD 86 R S + W+T VIV +HDD Sbjct: 116 RLSEVSSWITHVIVSQPTHDD 136 >Z50740-4|CAB60281.3| 1898|Caenorhabditis elegans Hypothetical protein F31B12.1a protein. Length = 1898 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 148 RESALPKWVTFVIVESTSHDD 86 R S + W+T VIV +HDD Sbjct: 116 RLSEVSSWITHVIVSQPTHDD 136 >U41279-6|AAK31423.1| 321|Caenorhabditis elegans Helix loop helix protein 27 protein. Length = 321 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 100 SIPLLRRLPTLEVLTPGSGDETSRSTYTD 186 S PL LP+L++LTP + DE D Sbjct: 290 SAPLRFILPSLQILTPETSDEEENEETVD 318 >AF044576-1|AAC38963.1| 1898|Caenorhabditis elegans phospholipase C PLC210 protein. Length = 1898 Score = 26.2 bits (55), Expect = 3.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 148 RESALPKWVTFVIVESTSHDD 86 R S + W+T VIV +HDD Sbjct: 116 RLSEVSSWITHVIVSQPTHDD 136 >U41279-4|AAK31421.1| 313|Caenorhabditis elegans Helix loop helix protein 25 protein. Length = 313 Score = 25.8 bits (54), Expect = 4.2 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 100 SIPLLRRLPTLEVLTPGSGDETSRSTYTD 186 S PL LP+L++LTP + DE D Sbjct: 282 SAPLRFILPSLQILTPETSDEEENEETLD 310 >U13019-7|AAC24445.2| 689|Caenorhabditis elegans Hypothetical protein T12A2.6 protein. Length = 689 Score = 25.0 bits (52), Expect = 7.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 161 KLLGVHTLIATNADGGLNSNYKIGDLMI 244 K LG H T+ + NS KIGD+++ Sbjct: 650 KFLGYHNSYTTDVNNPNNSVDKIGDMIV 677 >AC084197-18|AAM44394.1| 546|Caenorhabditis elegans Hypothetical protein Y73B6BL.4 protein. Length = 546 Score = 25.0 bits (52), Expect = 7.3 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +1 Query: 91 HARSIPLLRRLP-TLEVLTP 147 H S+PLLRR P T++ LTP Sbjct: 9 HRTSLPLLRRHPSTIDGLTP 28 >Z92831-2|CAB07368.2| 861|Caenorhabditis elegans Hypothetical protein F22G12.4 protein. Length = 861 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -1 Query: 256 MVLNNHQVANLIVGIQSTVRVRSN 185 M + +HQ+A+LIV Q V++N Sbjct: 518 MAMKDHQIASLIVARQPHAAVQTN 541 >Z81534-7|CAN86914.1| 3653|Caenorhabditis elegans Hypothetical protein T06D8.1b protein. Length = 3653 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 127 TLEVLTPGSGDETSRSTYTD 186 T V+T GSG+ET+ S T+ Sbjct: 1680 TTSVVTEGSGEETTTSAVTE 1699 >Z81534-6|CAN86913.1| 3719|Caenorhabditis elegans Hypothetical protein T06D8.1a protein. Length = 3719 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 127 TLEVLTPGSGDETSRSTYTD 186 T V+T GSG+ET+ S T+ Sbjct: 1680 TTSVVTEGSGEETTTSAVTE 1699 >Z75525-1|CAA99766.1| 262|Caenorhabditis elegans Hypothetical protein C03D6.1 protein. Length = 262 Score = 24.6 bits (51), Expect = 9.7 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -1 Query: 247 NNHQVANLIVGIQSTVRVRSNQCMYSEKFHHPNRESALPKWVTF 116 +N + NLIV + T+RVR+++ E + ++ L W F Sbjct: 182 SNEEFQNLIVNMFITIRVRNHRFSLLEPLWNAENKAGL--WTKF 223 >Z49130-10|CAD59157.2| 3653|Caenorhabditis elegans Hypothetical protein T06D8.1b protein. Length = 3653 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 127 TLEVLTPGSGDETSRSTYTD 186 T V+T GSG+ET+ S T+ Sbjct: 1680 TTSVVTEGSGEETTTSAVTE 1699 >Z49130-9|CAA88964.2| 3719|Caenorhabditis elegans Hypothetical protein T06D8.1a protein. Length = 3719 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 127 TLEVLTPGSGDETSRSTYTD 186 T V+T GSG+ET+ S T+ Sbjct: 1680 TTSVVTEGSGEETTTSAVTE 1699 >AL032667-2|CAN86634.1| 3653|Caenorhabditis elegans Hypothetical protein T06D8.1b protein. Length = 3653 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 127 TLEVLTPGSGDETSRSTYTD 186 T V+T GSG+ET+ S T+ Sbjct: 1680 TTSVVTEGSGEETTTSAVTE 1699 >AL032667-1|CAN86633.1| 3719|Caenorhabditis elegans Hypothetical protein T06D8.1a protein. Length = 3719 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 127 TLEVLTPGSGDETSRSTYTD 186 T V+T GSG+ET+ S T+ Sbjct: 1680 TTSVVTEGSGEETTTSAVTE 1699 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,458,074 Number of Sequences: 27780 Number of extensions: 119599 Number of successful extensions: 383 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 382 length of database: 12,740,198 effective HSP length: 69 effective length of database: 10,823,378 effective search space used: 227290938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -