BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_A10 (283 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL109839-6|CAI95635.1| 134|Homo sapiens chromosome 20 open read... 28 6.3 AL353588-3|CAI40747.1| 985|Homo sapiens alanyl-tRNA synthetase ... 27 8.4 >AL109839-6|CAI95635.1| 134|Homo sapiens chromosome 20 open reading frame 119 protein. Length = 134 Score = 27.9 bits (59), Expect = 6.3 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 24 LSKNVEVCNNLGAFSCCSCWSI 89 L+++ C L SCCSCWS+ Sbjct: 87 LARSRACCWRLTTQSCCSCWSL 108 >AL353588-3|CAI40747.1| 985|Homo sapiens alanyl-tRNA synthetase 2, mitochondrial (putative) protein. Length = 985 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -1 Query: 229 DWVPTVAVCIGLRIYPWLTGKPVTTSTMFRDVRRYA 122 D + T++VCI I+P ++G P+ + R R++ Sbjct: 326 DHIRTLSVCISDGIFPGMSGPPLVLRRILRRAVRFS 361 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,680,425 Number of Sequences: 237096 Number of extensions: 908009 Number of successful extensions: 1536 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1536 length of database: 76,859,062 effective HSP length: 70 effective length of database: 60,262,342 effective search space used: 1386033866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -