BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_A08 (585 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 34 0.061 At2g21410.1 68415.m02548 vacuolar proton ATPase, putative simila... 30 0.99 At4g39080.1 68417.m05534 vacuolar proton ATPase, putative simila... 29 1.7 At3g02280.1 68416.m00209 flavodoxin family protein low similarit... 29 3.0 At1g70900.1 68414.m08181 expressed protein 29 3.0 At1g23110.1 68414.m02889 hypothetical protein 29 3.0 At5g19010.1 68418.m02258 mitogen-activated protein kinase, putat... 28 5.3 At5g18840.1 68418.m02239 sugar transporter, putative similar to ... 28 5.3 At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein si... 28 5.3 At4g01290.1 68417.m00170 expressed protein 28 5.3 At3g25140.1 68416.m03139 glycosyl transferase family 8 protein c... 28 5.3 At5g35940.1 68418.m04325 jacalin lectin family protein similar t... 27 7.0 At4g30550.1 68417.m04336 glutamine amidotransferase class-I doma... 27 7.0 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 27 7.0 At2g20170.1 68415.m02358 hypothetical protein and grail contain... 27 7.0 At2g16530.2 68415.m01896 3-oxo-5-alpha-steroid 4-dehydrogenase f... 27 7.0 At5g59920.1 68418.m07514 DC1 domain-containing protein contains ... 27 9.2 At5g13460.1 68418.m01549 calmodulin-binding family protein low s... 27 9.2 At4g11120.1 68417.m01804 translation elongation factor Ts (EF-Ts... 27 9.2 At3g13170.1 68416.m01647 DNA topoisomerase VIA (SPO11-1) identic... 27 9.2 At3g06890.1 68416.m00818 expressed protein 27 9.2 At2g32830.1 68415.m04019 inorganic phosphate transporter (PHT5) ... 27 9.2 At2g23990.2 68415.m02866 plastocyanin-like domain-containing pro... 27 9.2 At2g23990.1 68415.m02865 plastocyanin-like domain-containing pro... 27 9.2 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 34.3 bits (75), Expect = 0.061 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 3/114 (2%) Frame = +3 Query: 168 NVVSSPLGVMMLMLLYKAGAGEGSRAEIDKFLGNGDYSGVANPYISLSKTFSEMNPDYFT 347 NVV SP+ + +L+ L AG+ ++ EI FL + + ++ +E + + Sbjct: 31 NVVFSPMSINVLLSLIAAGSNPVTKEEILSFLMSPSTDHLNAVLAKIADGGTERSDLCLS 90 Query: 348 MANKIYVGNKYTLDEKF-TITVRQYQSEVETIDFSDTK--KAADIINQWANEKT 500 A+ +++ L F + Y++ +DF+ TK + D +N WA+ T Sbjct: 91 TAHGVWIDKSSYLKPSFKELLENSYKASCSQVDFA-TKPVEVIDEVNIWADVHT 143 >At2g21410.1 68415.m02548 vacuolar proton ATPase, putative similar to vacuolar proton ATPase 100-kDa subunit from Dictyostelium discoideum P|1384136|gb|AAB49621 Length = 821 Score = 30.3 bits (65), Expect = 0.99 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +1 Query: 388 MRNSRSLSVSTKAKLKLLTSAIPKKQLTSLISGLMRRPRGHI---KSPISDDTIDPNA 552 ++ +S+ + + KL LT +P+++ L R RG+I +S I + +DPN+ Sbjct: 178 LQEEKSVDPTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQSVIEESVVDPNS 235 >At4g39080.1 68417.m05534 vacuolar proton ATPase, putative similar to Swiss-Prot:Q93050 vacuolar proton translocating ATPase 116 kDa subunit A isoform 1 (Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit, Vacuolar proton pump subunit 1, Vacuolar adenosine triphosphatase subunit Ac116) [Homo sapiens] Length = 821 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +1 Query: 388 MRNSRSLSVSTKAKLKLLTSAIPKKQLTSLISGLMRRPRGHI---KSPISDDTIDPNA 552 ++ +S+ + + KL LT +P+++ L R RG+I ++ I + IDPN+ Sbjct: 177 LQEEKSIDSTKQVKLGFLTGLVPREKSMVFERILFRATRGNIFIRQTVIEEPVIDPNS 234 >At3g02280.1 68416.m00209 flavodoxin family protein low similarity to SP|Q05001 NADPH-cytochrome P450 reductase (EC 1.6.2.4) {Catharanthus roseus}, similar to NADPH-dependent FMN and FAD containing oxidoreductase [Homo sapiens] GI:6694369; contains Pfam profiles PF00258: flavodoxin, PF00667: FAD binding domain, PF00175: Oxidoreductase NAD-binding domain Length = 623 Score = 28.7 bits (61), Expect = 3.0 Identities = 22/80 (27%), Positives = 40/80 (50%), Gaps = 7/80 (8%) Frame = +3 Query: 234 GSRAEIDKFLGNGD----YSGVANPY-ISLSKTFSEMNPDYFTMANKIYVGNKYTLDE-K 395 G+ I+K LG+ Y G +P+ +SL +T ++NP YF + + +D+ K Sbjct: 123 GATTIIEKGLGDDQHPSGYEGTLDPWMLSLWRTLYQINPKYFPKGPDVKIPQDEVIDKPK 182 Query: 396 FTITV-RQYQSEVETIDFSD 452 + I +Q + E + + SD Sbjct: 183 YRILFHKQEKLEPKLLSDSD 202 >At1g70900.1 68414.m08181 expressed protein Length = 244 Score = 28.7 bits (61), Expect = 3.0 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +3 Query: 165 KNVVSSPLGVMMLMLLYKAGAGEGSRAEIDKFLGNGDYSGVANPYISLSKTFSEMNPDYF 344 K +S +GV + LY + SR + K+L DY+ +A I L++ E NP + Sbjct: 103 KVYANSLIGVGIASSLYHS-----SRGKFRKYLRWADYTMIATATICLTRALREENPKFL 157 Query: 345 TMANKI 362 A+ + Sbjct: 158 MAASAL 163 >At1g23110.1 68414.m02889 hypothetical protein Length = 261 Score = 28.7 bits (61), Expect = 3.0 Identities = 20/66 (30%), Positives = 32/66 (48%) Frame = +3 Query: 165 KNVVSSPLGVMMLMLLYKAGAGEGSRAEIDKFLGNGDYSGVANPYISLSKTFSEMNPDYF 344 K +S +GV + LY A SR ++ K+L DY+ +A I LS+ NP + Sbjct: 120 KVYANSLIGVGIASSLYHA-----SRGKLRKYLRWVDYTMIATTTICLSRALRNENPKFL 174 Query: 345 TMANKI 362 A+ + Sbjct: 175 MAASAL 180 >At5g19010.1 68418.m02258 mitogen-activated protein kinase, putative / MAPK, putative (MPK16) mitogen-activated protein kinase (MAPK)(AtMPK16), PMID:12119167; similar to ATMPK9, Arabidopsis thaliana, EMBL:AB038694 Length = 567 Score = 27.9 bits (59), Expect = 5.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 228 GEGSRAEIDKFLGNGDYSGVANPY 299 GEGSR I++ +G G Y V + Y Sbjct: 20 GEGSRYRIEEVIGKGSYGVVCSAY 43 >At5g18840.1 68418.m02239 sugar transporter, putative similar to ERD6 protein {Arabidopsis thaliana} GI:3123712, sugar-porter family protein 1 [Arabidopsis thaliana] GI:14585699; contains Pfam profile PF00083: major facilitator superfamily protein Length = 482 Score = 27.9 bits (59), Expect = 5.3 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 2/86 (2%) Frame = -2 Query: 572 TLKSAAAAFGSMVSSEIGDLICPRGLLISPLINDVSCFFGIAEVNSFNFALVLTDSDREF 393 TL GS VS IG LI + L ++ L + FG+ + L ++EF Sbjct: 173 TLNQLMIVIGSSVSFLIGSLISWKTLALTGLAPCIVLLFGLCFIPESPRWLAKAGHEKEF 232 Query: 392 --LIQSIFISDVDFIGHSEVIRIHLR 321 +Q + D D ++ I++ ++ Sbjct: 233 RVALQKLRGKDADITNEADGIQVSIQ 258 >At5g14950.1 68418.m01754 glycosyl hydrolase family 38 protein similar to alpha-mannosidase II SP:P27046 from [Mus musculus] Length = 1173 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -3 Query: 217 LYRSISIITPNGEDTTFLSFDDVYVSLRN 131 LYR+ +++ P G+D ++S D+ RN Sbjct: 401 LYRTNTLLIPLGDDFRYISIDEAEAQFRN 429 >At4g01290.1 68417.m00170 expressed protein Length = 991 Score = 27.9 bits (59), Expect = 5.3 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 352 PIKSTSEINILWMRNSRSLSVSTKAKLKLLT----SAIPKKQLTSLISGLMRRP 501 P+ + + + M R SV +A LL+ S+ PK Q T L+S RRP Sbjct: 584 PVDQDTSVPSVKMTKQRKTSVDDQASQHLLSLLQRSSDPKSQDTQLLSATERRP 637 >At3g25140.1 68416.m03139 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 559 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/77 (22%), Positives = 35/77 (45%) Frame = +3 Query: 168 NVVSSPLGVMMLMLLYKAGAGEGSRAEIDKFLGNGDYSGVANPYISLSKTFSEMNPDYFT 347 +VV+ + + + +++K +G+ E+ DY+ + + Y+ + K N F Sbjct: 281 HVVTDKMNLGAMQVMFKLKEYKGAHVEVKAV---EDYTFLNSSYVPVLKQLESANLQKFY 337 Query: 348 MANKIYVGNKYTLDEKF 398 NK+ K T + KF Sbjct: 338 FENKLENATKDTTNMKF 354 >At5g35940.1 68418.m04325 jacalin lectin family protein similar to myrosinase-binding protein homolog [Arabidopsis thaliana] GI:2997767; contains Pfam profile PF01419 jacalin-like lectin domain Length = 444 Score = 27.5 bits (58), Expect = 7.0 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +3 Query: 162 DKNVVSSPLGVMMLMLLYKAGAGEGSRAEIDKFLGNGDYSGVANPYISLSKT-FSEMNPD 338 DKNV S LG + +L +G + + GDY G+ Y++ T M D Sbjct: 131 DKNVYS--LGAYFIKVLATKSGMQGGQNTGKSYDYGGDYDGIRKVYVTYDGTSIRHMRVD 188 Query: 339 Y 341 Y Sbjct: 189 Y 189 >At4g30550.1 68417.m04336 glutamine amidotransferase class-I domain-containing protein similar to defense-related protein [Brassica carinata] GI:14009290, component of aniline dioxygenase (GMP synthase like protein) - Acinetobacter sp.,PID:d1013698; contains Pfam profile PF00117: glutamine amidotransferase class-I Length = 249 Score = 27.5 bits (58), Expect = 7.0 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 8/60 (13%) Frame = +3 Query: 27 LLAVIAVCNVRAFYSSDH--------EYNRTALGDAIDKTSLQFLKETYTSSKDKNVVSS 182 LLA VCNV F DH EYN+ L + +D+ L E + K K+ + + Sbjct: 172 LLASSEVCNVEMFSIGDHFFCIQGHPEYNKEILFEIVDRVLNMKLMEQEFADKAKSTMET 231 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 252 DKFLGNGDYSGVANPYISLSKTFSEMNPDYFTMANKIYVGN 374 D++L Y P I KT S P+ N++Y+GN Sbjct: 228 DRYLTIQQYVKTTTPSIPRRKTSSGFAPEMVDGYNRVYIGN 268 >At2g20170.1 68415.m02358 hypothetical protein and grail contains Pfam profile PF03080: Arabidopsis proteins of unknown function Length = 401 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +3 Query: 90 RTALGDAIDKTSLQFLKETYTSSKDKNVVS 179 RT L D I L++L YT+SKDK+ ++ Sbjct: 121 RTTLEDLIQIQRLKYLGVKYTTSKDKDFLN 150 >At2g16530.2 68415.m01896 3-oxo-5-alpha-steroid 4-dehydrogenase family protein / steroid 5-alpha-reductase family protein similar to Arabidopsis thaliana DET2 [gi:1280611]; contains Pfam 3-oxo-5-alpha-steroid 4-dehydrogenase domain PF02544 Length = 342 Score = 27.5 bits (58), Expect = 7.0 Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +1 Query: 370 EINILWMRNSRSLSVSTKAKLKLLTSAIPKKQLTSLISGLMR-RPRGHIKSPISDDTIDP 546 E+ I+W+ ++V + L L+ ++IP +L S ++ RG I P S TI P Sbjct: 3 ELEIVWLVRGAWITVWIVSILPLVIASIPTSKLNSFRELVLSFAGRGKILHPSSQFTI-P 61 Query: 547 NAAAALFNVI 576 A F VI Sbjct: 62 QKCFAHFYVI 71 >At5g59920.1 68418.m07514 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 710 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +2 Query: 83 VQQDSLRRCH*QNFFAVS*GNVYIIEGQECCVFTIRRDDAN 205 V D RRC V G++Y+ E +ECC F + AN Sbjct: 384 VIHDERRRCE-ACIHPVQFGSIYVCEEEECC-FVLHEKCAN 422 >At5g13460.1 68418.m01549 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 443 Score = 27.1 bits (57), Expect = 9.2 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = +3 Query: 375 KYTLDEKFTITVRQYQSEVETIDFSDTKKAADIINQWANEKTPRTY*ISNL**HHRSECS 554 KY LDE + T E+E +DFS K D KTPR L +HR + S Sbjct: 255 KYWLDE-WVDTQLTKSKELEDLDFSSKTKPKDETLNEKQLKTPRNSSPRRLVNNHRRQVS 313 >At4g11120.1 68417.m01804 translation elongation factor Ts (EF-Ts), putative similar to ethylene-responsive elongation factor EF-Ts precursor [Lycopersicon esculentum] GI:5669636; contains Pfam profile PF00889: Elongation factor TS Length = 395 Score = 27.1 bits (57), Expect = 9.2 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 339 YFTMANKIYVGNKY-TLDEKFTITVRQYQSEVETIDFSDTKKAADIINQWANEKTP 503 Y++++++ GN+Y T+ KF T+ QY+S V + S + + I +++E P Sbjct: 15 YYSVSSRFSSGNEYSTVASKFE-TLSQYKSSVPSGYTSLVRGFGNFIRSFSSEAPP 69 >At3g13170.1 68416.m01647 DNA topoisomerase VIA (SPO11-1) identical to AtSPO11-1 [Arabidopsis thaliana] GI:13383478; contains Pfam profile PF04406: Type IIB DNA topoisomerase; identical to cDNA putative topoisomerase VIA (SPO11 gene 1) GI:7270974 Length = 362 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 105 DAIDKTSLQFLKETYTSSKDKNVVSSP 185 +A+ SL FL E Y SK + VSSP Sbjct: 336 EALSVHSLSFLSEVYIPSKIRREVSSP 362 >At3g06890.1 68416.m00818 expressed protein Length = 128 Score = 27.1 bits (57), Expect = 9.2 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -2 Query: 545 GSMVSSEIGDLICPRGLLISPLINDVSCFFGIAEVNSFNFALVLT 411 G ++ I +L+ P GLL+ P+I ++ F +E SF A+ T Sbjct: 42 GEAITDAIAELLSPVGLLLLPIILLLTIQFLSSERGSFVSAIFST 86 >At2g32830.1 68415.m04019 inorganic phosphate transporter (PHT5) identical to inorganic phosphate transporter (PHT5) [Arabidopsis thaliana] GI:2780345 Length = 542 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +1 Query: 472 SLISGLMRRPRGHIKSPISDDTIDPNAAAALFNVIF 579 SL++ L+ R H+ S T+ PN AAA+ V F Sbjct: 43 SLVTKLLGRIYYHVDSSKKPGTLPPNVAAAVNGVAF 78 >At2g23990.2 68415.m02866 plastocyanin-like domain-containing protein Length = 226 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 274 SPLPKNLSISARLPSPAPALYRSISIITPNG 182 +P PK+ S S P+PAPA ++ ++ NG Sbjct: 181 TPSPKS-STSTMAPAPAPAKSSAVGLVAGNG 210 >At2g23990.1 68415.m02865 plastocyanin-like domain-containing protein Length = 207 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 274 SPLPKNLSISARLPSPAPALYRSISIITPNG 182 +P PK+ S S P+PAPA ++ ++ NG Sbjct: 162 TPSPKS-STSTMAPAPAPAKSSAVGLVAGNG 191 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,695,966 Number of Sequences: 28952 Number of extensions: 265100 Number of successful extensions: 817 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 798 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -