BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0007_A06 (581 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) 29 2.8 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) 27 8.5 >SB_34310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = -3 Query: 180 PFHRGNQFSCHTIRICLSVGTVRKSFQKCPRTVLL-RSSLRCVDC 49 P H NQ C IC+ G KS KCP L S RC C Sbjct: 245 PCHEANQGGCEGRAICVYTGP-GKSICKCPPGYKLDESQARCTLC 288 >SB_32707| Best HMM Match : Peptidase_A17 (HMM E-Value=4.8e-22) Length = 2269 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 7/51 (13%) Frame = +3 Query: 123 LQKGKFE-----SYGKKIDFHDEKAINFVGNYWQENADL--YEEEVTKDYQ 254 L+KGKF+ S K ID E+ F+G+ W ++ DL +++E K+ Q Sbjct: 1093 LEKGKFQVKQWCSNSKTIDKSCERYCTFLGHKWDKDRDLLTFKKEKIKETQ 1143 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 28.7 bits (61), Expect = 3.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = +3 Query: 33 QRPDNYNLHSVKNYEAIRFLDIFEKTFVQSLQKGKFESYGKKIDFHD 173 Q+P+N++LH +A+ T L GKF+S G+ D H+ Sbjct: 4733 QKPNNHHLHRTCKADALEV----NVTLRGGLHAGKFKSVGRTRDVHE 4775 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 28.3 bits (60), Expect = 4.8 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +1 Query: 283 CSVQHLNHSTSTPSCPVRLTFTKP-DFENLHSISYITGL 396 CSV L +T + PVR+T T P F N S IT L Sbjct: 2287 CSVTWLKDNTPLDTSPVRITVTHPGSFGNTTSSLTITNL 2325 >SB_1853| Best HMM Match : RVT_1 (HMM E-Value=5.99994e-41) Length = 1069 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +3 Query: 138 FESYGKKIDFHDEKAINFVGNYWQENADLYEEEVTKDYQRSYEIVAR 278 FE Y ++ DEKA ++ Y ++ A + E +RSY + + Sbjct: 138 FEIYVSLNEWQDEKAGQYLAVYLKDEAKAFYHEQEDSVRRSYRALCK 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,272,444 Number of Sequences: 59808 Number of extensions: 352657 Number of successful extensions: 1026 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1023 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1397989795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -