BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_P23 (445 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55834| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_5301| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_44915| Best HMM Match : VWA (HMM E-Value=0) 27 7.0 SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) 27 7.0 SB_39378| Best HMM Match : VWA (HMM E-Value=0) 27 7.0 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.0 SB_57784| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_19649| Best HMM Match : Keratin_B2 (HMM E-Value=0.082) 27 9.2 SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) 27 9.2 SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) 27 9.2 SB_56365| Best HMM Match : SDH_beta (HMM E-Value=7.6) 27 9.2 SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 >SB_55834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 322 HLTEMIYHIFHYYITTHLPHPQTRXM-HLYKY 414 +LT M + H+Y+TT L HP T HL+++ Sbjct: 105 YLTTMFVIMSHHYLTTFLRHPVTPLPDHLFRH 136 >SB_5301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -3 Query: 272 SYRLGXDNXG*FEIDRTPVQCLWVH-NFR 189 +YR+G + G F+ D + + CL VH NF+ Sbjct: 253 AYRIGEEIVGSFDFDDSLISCLKVHTNFK 281 >SB_44915| Best HMM Match : VWA (HMM E-Value=0) Length = 541 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +2 Query: 140 VIANPDPFFSQP-SNGPSGNYEPISTG 217 VIA PDP S+P +NG G PIS+G Sbjct: 258 VIAEPDPCLSKPCANG--GTCSPISSG 282 >SB_13163| Best HMM Match : VWA (HMM E-Value=2.3e-32) Length = 318 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +2 Query: 140 VIANPDPFFSQP-SNGPSGNYEPISTG 217 VIA PDP S+P +NG G PIS+G Sbjct: 54 VIAEPDPCLSKPCANG--GTCSPISSG 78 >SB_39378| Best HMM Match : VWA (HMM E-Value=0) Length = 2865 Score = 27.1 bits (57), Expect = 7.0 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +2 Query: 140 VIANPDPFFSQP-SNGPSGNYEPISTG 217 VIA PDP S+P +NG G PIS+G Sbjct: 409 VIAEPDPCLSKPCANG--GTCSPISSG 433 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 27.1 bits (57), Expect = 7.0 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +2 Query: 194 NYEPISTGPAFGRFQIIXNYPXPSDTKQPSRPVVG 298 N+EP+ G + R +I NY PS +++ + + G Sbjct: 14 NHEPMENGTSDERTNLIINYVPPSMSQEDIKKIFG 48 >SB_57784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 208 KHWTGVRSISNHPQLSXPKRYETTLSP 288 +HW+G SI+ PQ S K YE T P Sbjct: 165 EHWSGPDSITVEPQQS--KNYELTYRP 189 >SB_19649| Best HMM Match : Keratin_B2 (HMM E-Value=0.082) Length = 279 Score = 26.6 bits (56), Expect = 9.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 208 KHWTGVRSISNHPQLSXPKRYETT 279 KH T ++ +N P + P +Y+TT Sbjct: 52 KHQTASKAPNNQPSIKQPAKYQTT 75 >SB_7134| Best HMM Match : HMG_box (HMM E-Value=2e-16) Length = 228 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 95 VDNSGVPSDGNSDHVVIANPDPFFSQ 172 VD+SGV D S +V A +P FSQ Sbjct: 161 VDSSGVAGDQRSSLLVSATLNPLFSQ 186 >SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) Length = 173 Score = 26.6 bits (56), Expect = 9.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 124 AVRWNTTIVHHVNSVCGSHGQY 59 A RW T H+ +CG HG+Y Sbjct: 55 ATRWTTN--HNCYHICGHHGRY 74 >SB_56365| Best HMM Match : SDH_beta (HMM E-Value=7.6) Length = 331 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +1 Query: 208 KHWTGVRSISNHPQLSXPKRYETTLSP 288 +HW+G SI+ PQ S K YE T P Sbjct: 296 EHWSGPDSITVEPQQS--KNYELTYRP 320 >SB_49511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 26.6 bits (56), Expect = 9.2 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 95 VDNSGVPSDGNSDHVVIANPDPFFSQ 172 VD+SGV D S +V A +P FSQ Sbjct: 90 VDSSGVAGDQRSSLLVSATLNPLFSQ 115 >SB_3457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 26.6 bits (56), Expect = 9.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 134 GHYCRPMEHHYCPPRELCLR 75 GH C+P CPP C+R Sbjct: 805 GHQCQPDTCDSCPPNSHCMR 824 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,462,186 Number of Sequences: 59808 Number of extensions: 280840 Number of successful extensions: 724 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 871599479 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -