BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_P16 (502 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z82096-7|CAB05033.2| 332|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z81533-3|CAB04335.1| 327|Caenorhabditis elegans Hypothetical pr... 29 1.9 Z79756-1|CAB02120.2| 494|Caenorhabditis elegans Hypothetical pr... 28 4.4 Z66519-6|CAA91374.3| 394|Caenorhabditis elegans Hypothetical pr... 28 4.4 Z81557-14|CAN99712.1| 321|Caenorhabditis elegans Hypothetical p... 27 7.6 Z81557-13|CAB04530.2| 303|Caenorhabditis elegans Hypothetical p... 27 7.6 AL032657-1|CAA21732.1| 377|Caenorhabditis elegans Hypothetical ... 27 7.6 >Z82096-7|CAB05033.2| 332|Caenorhabditis elegans Hypothetical protein ZK909.5 protein. Length = 332 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 191 YSAKDYDTFYKTTVYMKDRVNQDLYIYVLST 283 YS Y +K+ +Y K+R NQ+ YI V+ + Sbjct: 69 YSETQYWYTFKSDIYRKERTNQEGYIEVMKS 99 >Z81533-3|CAB04335.1| 327|Caenorhabditis elegans Hypothetical protein F36G9.5 protein. Length = 327 Score = 29.1 bits (62), Expect = 1.9 Identities = 17/58 (29%), Positives = 27/58 (46%) Frame = +2 Query: 320 IPPIYEVLPEYFNNGEILHTAQRIGVHGSRMIEYYPSTYKWDNSVVIRSNTTVWHYHC 493 I PI + + NG H A I +GS M+ + + W N+ ++ NT +W C Sbjct: 163 IYPILCIAIMFPGNGFCSHVAYPI--YGSIMLRVTDTMFGWTNNYILMFNTFLWVSIC 218 >Z79756-1|CAB02120.2| 494|Caenorhabditis elegans Hypothetical protein F53C11.1 protein. Length = 494 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +2 Query: 101 KQNWLLPLSVPFSPLNPTHQFEAVIMFNV 187 KQN+ V F+PL PTH + V+ ++V Sbjct: 280 KQNFPGEKFVSFTPLTPTHAYSNVLAYSV 308 >Z66519-6|CAA91374.3| 394|Caenorhabditis elegans Hypothetical protein B0334.6 protein. Length = 394 Score = 27.9 bits (59), Expect = 4.4 Identities = 19/60 (31%), Positives = 29/60 (48%) Frame = +2 Query: 119 PLSVPFSPLNPTHQFEAVIMFNVLYSAKDYDTFYKTTVYMKDRVNQDLYIYVLSTLHIHR 298 PLS+P + + F VLY TFYK++V + N + Y+ V+ L+ HR Sbjct: 102 PLSIPSLAFSTS--FNHFYSRIVLYIRTLASTFYKSSVLIVVAFNIERYLCVVCPLNSHR 159 >Z81557-14|CAN99712.1| 321|Caenorhabditis elegans Hypothetical protein F59A1.11b protein. Length = 321 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 80 KIWILMKKQNWLL-PLSVPFSPLNPTHQFEAVIMFNVLYSAKDYDTFYK 223 +++I+ KK LL +++P + P +AVI + V+ S +D + F+K Sbjct: 137 RLFIIKKKSLVLLYSIAIPLMLIGPIS--DAVIAYPVILSGQDMNVFFK 183 >Z81557-13|CAB04530.2| 303|Caenorhabditis elegans Hypothetical protein F59A1.11a protein. Length = 303 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 80 KIWILMKKQNWLL-PLSVPFSPLNPTHQFEAVIMFNVLYSAKDYDTFYK 223 +++I+ KK LL +++P + P +AVI + V+ S +D + F+K Sbjct: 137 RLFIIKKKSLVLLYSIAIPLMLIGPIS--DAVIAYPVILSGQDMNVFFK 183 >AL032657-1|CAA21732.1| 377|Caenorhabditis elegans Hypothetical protein Y47H9C.1 protein. Length = 377 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 182 NVLYSAKDYDTFYKTTVYMKDRVNQDLYIYVLSTLHIHRSDLEGYAI-PPIY 334 N+ SA+ DT + +VY+ N + ++ + +++GY + PP Y Sbjct: 42 NIYISAQSDDTSFLASVYIVTAKNSKSLLNIMQDNLQNTGEIQGYPVDPPAY 93 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,839,598 Number of Sequences: 27780 Number of extensions: 255043 Number of successful extensions: 608 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 956602620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -