BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_P14 (396 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5MGH6 Cluster: Protease inhibitor 1; n=1; Lonomia obli... 50 1e-05 UniRef50_Q0Q016 Cluster: Protease inhibitor-like protein; n=2; A... 41 0.008 UniRef50_Q2F5I4 Cluster: Protease inhibitor 1; n=1; Bombyx mori|... 35 0.66 UniRef50_Q9CLW8 Cluster: Putative uncharacterized protein PM1081... 32 3.5 UniRef50_Q8I3F7 Cluster: Putative uncharacterized protein PFE155... 32 4.6 >UniRef50_Q5MGH6 Cluster: Protease inhibitor 1; n=1; Lonomia obliqua|Rep: Protease inhibitor 1 - Lonomia obliqua (Moth) Length = 155 Score = 50.4 bits (115), Expect = 1e-05 Identities = 35/85 (41%), Positives = 40/85 (47%) Frame = +2 Query: 77 MDKLCALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYR 256 M KLC LI G +ASQ M R +RQ NN N N+S D PIQN + Sbjct: 1 MGKLCMFLIFGLVASQTASMYTRERRQAGNN-------NTPNRSTDR-----FPIQNVFP 48 Query: 257 IQYPLDNNYNFIAFIFPNQVQFPNQ 331 Q P D+N N F NQ Q NQ Sbjct: 49 EQNPFDDNMNIDIIDFLNQAQIGNQ 73 >UniRef50_Q0Q016 Cluster: Protease inhibitor-like protein; n=2; Antheraea mylitta|Rep: Protease inhibitor-like protein - Antheraea mylitta (Tasar silkworm) Length = 99 Score = 41.1 bits (92), Expect = 0.008 Identities = 17/33 (51%), Positives = 20/33 (60%) Frame = +2 Query: 77 MDKLCALLILGFIASQATCMNIRYKRQIENNAN 175 MDKLC I G I Q CM++R KRQ +N N Sbjct: 1 MDKLCLFFIFGIIVGQTVCMSVRNKRQADNILN 33 >UniRef50_Q2F5I4 Cluster: Protease inhibitor 1; n=1; Bombyx mori|Rep: Protease inhibitor 1 - Bombyx mori (Silk moth) Length = 148 Score = 34.7 bits (76), Expect = 0.66 Identities = 26/85 (30%), Positives = 38/85 (44%) Frame = +2 Query: 77 MDKLCALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYR 256 MDKL + I + CM++R KRQ ++ ++ D+ GW + RP Sbjct: 1 MDKLVVFFLFAIITN-VLCMSVRNKRQSNDDDDVLDDRYGWELT---TRPP--------- 47 Query: 257 IQYPLDNNYNFIAFIFPNQVQFPNQ 331 Q+P F +FP Q QFP Q Sbjct: 48 RQFP---GQGFFPGLFPGQGQFPGQ 69 >UniRef50_Q9CLW8 Cluster: Putative uncharacterized protein PM1081; n=1; Pasteurella multocida|Rep: Putative uncharacterized protein PM1081 - Pasteurella multocida Length = 809 Score = 32.3 bits (70), Expect = 3.5 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 161 ENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNYNF 289 EN + + GW K DGN P P++ G + DN +F Sbjct: 687 ENYDMVGVQPTGWEKQPDGNAPRMSPMRLGIKWNAYFDNGISF 729 >UniRef50_Q8I3F7 Cluster: Putative uncharacterized protein PFE1555c; n=2; Plasmodium|Rep: Putative uncharacterized protein PFE1555c - Plasmodium falciparum (isolate 3D7) Length = 2698 Score = 31.9 bits (69), Expect = 4.6 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +2 Query: 113 IASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRI-QYPLDNNYNF 289 + C + K+ I+NN N + N N + + N + N Y +YP++NNYN+ Sbjct: 301 VQDNTKCYYKKKKKLIKNNNN---NNNNNNDNNNNNNND----NNNYNYNKYPINNNYNY 353 Query: 290 IAFIFPNQVQFPN 328 N + PN Sbjct: 354 NTHKNDNHISDPN 366 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 406,055,318 Number of Sequences: 1657284 Number of extensions: 8063877 Number of successful extensions: 21015 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20978 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16503508437 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -