BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_P09 (414 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81143-3|CAB03519.2| 276|Caenorhabditis elegans Hypothetical pr... 29 1.3 Z79598-2|CAB01864.1| 738|Caenorhabditis elegans Hypothetical pr... 28 3.1 U39648-6|AAM15602.1| 557|Caenorhabditis elegans Abnormal dauer ... 28 3.1 AF407572-1|AAL65132.1| 557|Caenorhabditis elegans DAF-9 isoform... 28 3.1 Z82272-9|CAB05224.1| 341|Caenorhabditis elegans Hypothetical pr... 27 4.1 Z81146-8|CAB03527.1| 341|Caenorhabditis elegans Hypothetical pr... 27 4.1 U70844-7|AAB09097.1| 686|Caenorhabditis elegans Adam (disintegr... 27 5.4 AF045645-5|AAL06039.2| 140|Caenorhabditis elegans Ground-like (... 27 5.4 AF025471-3|AAB71061.1| 183|Caenorhabditis elegans Hypothetical ... 27 7.1 AF016418-2|AAK18901.1| 893|Caenorhabditis elegans Hypothetical ... 27 7.1 Z81124-5|CAB03374.1| 328|Caenorhabditis elegans Hypothetical pr... 26 9.4 >Z81143-3|CAB03519.2| 276|Caenorhabditis elegans Hypothetical protein ZK265.4 protein. Length = 276 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -2 Query: 353 YISEFHPPNVSYSASEDKYGSRFLSANPLGFPVDRPLH 240 +ISE+HPP + Y + + F + P+ FP P+H Sbjct: 229 FISEYHPPFIPYYIPNQSFSNAF-NQYPMPFPY--PIH 263 >Z79598-2|CAB01864.1| 738|Caenorhabditis elegans Hypothetical protein C44H4.2 protein. Length = 738 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/68 (29%), Positives = 30/68 (44%) Frame = -2 Query: 365 VLMVYISEFHPPNVSYSASEDKYGSRFLSANPLGFPVDRPLHLWXXXXXXXXXXNFHDVM 186 +L+V +SE P YSA + G+ L NPL LH+ + D++ Sbjct: 366 LLLVDLSENKLPKTPYSAFNSRVGTVLLKENPL--VCTENLHMLQQGTGVYVRDS-PDII 422 Query: 185 IHHKPTPE 162 KPTP+ Sbjct: 423 CGRKPTPK 430 >U39648-6|AAM15602.1| 557|Caenorhabditis elegans Abnormal dauer formation protein9, isoform b protein. Length = 557 Score = 27.9 bits (59), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 321 LQCKRRQVWFSIPICQSSWL 262 L C+R +W ++ I QSSW+ Sbjct: 11 LSCERASIWCNMNISQSSWI 30 >AF407572-1|AAL65132.1| 557|Caenorhabditis elegans DAF-9 isoform A protein. Length = 557 Score = 27.9 bits (59), Expect = 3.1 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -1 Query: 321 LQCKRRQVWFSIPICQSSWL 262 L C+R +W ++ I QSSW+ Sbjct: 11 LSCERASIWCNMNISQSSWI 30 >Z82272-9|CAB05224.1| 341|Caenorhabditis elegans Hypothetical protein F55G11.4 protein. Length = 341 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 414 PAPSLITERSCWWYAVCIDGLY 349 PAP L E+SC WY G Y Sbjct: 49 PAPQLEKEQSCSWYVTIPRGYY 70 >Z81146-8|CAB03527.1| 341|Caenorhabditis elegans Hypothetical protein F55G11.4 protein. Length = 341 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 414 PAPSLITERSCWWYAVCIDGLY 349 PAP L E+SC WY G Y Sbjct: 49 PAPQLEKEQSCSWYVTIPRGYY 70 >U70844-7|AAB09097.1| 686|Caenorhabditis elegans Adam (disintegrin plus metalloprotease)family protein 4 protein. Length = 686 Score = 27.1 bits (57), Expect = 5.4 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 126 NNIRLKVVRNYDLWSRFVMDHDIVEVDILNVVVCNLPQV*WPINWE 263 N LK+V +Y +S F ++ + L ++ + ++ PINW+ Sbjct: 187 NRCTLKLVADYSFYSIFGKNNTGIVTKFLVNMIARVNEIYTPINWD 232 >AF045645-5|AAL06039.2| 140|Caenorhabditis elegans Ground-like (grd related) protein26 protein. Length = 140 Score = 27.1 bits (57), Expect = 5.4 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 202 LIF*MLLFVICHRCSGLSTG 261 LIF +L F +CH C+GL G Sbjct: 10 LIFAILFFDLCHGCAGLFGG 29 >AF025471-3|AAB71061.1| 183|Caenorhabditis elegans Hypothetical protein R52.5 protein. Length = 183 Score = 26.6 bits (56), Expect = 7.1 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 312 CTVGNVRWMEFRNIDHQ 362 C+ G V WM FRN+D + Sbjct: 87 CSDGKVAWMIFRNVDFE 103 >AF016418-2|AAK18901.1| 893|Caenorhabditis elegans Hypothetical protein C49G7.7 protein. Length = 893 Score = 26.6 bits (56), Expect = 7.1 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -1 Query: 414 PAPSLITERSCWWYAVCIDGLY 349 PAP L TE+SC W G Y Sbjct: 361 PAPQLETEQSCSWIVTIPRGYY 382 >Z81124-5|CAB03374.1| 328|Caenorhabditis elegans Hypothetical protein T21B4.7 protein. Length = 328 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = -1 Query: 162 DRSSLQLLNEYYFNGFLYVYIYVYLNI 82 +RSS+ L N++ F+ LY I+++LNI Sbjct: 126 NRSSMILENKFRFSINLYRVIWIFLNI 152 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,482,858 Number of Sequences: 27780 Number of extensions: 202540 Number of successful extensions: 460 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 673122114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -