BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_P07 (395 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1... 29 0.35 SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 27 0.80 SPBC25H2.03 |||vacuolar protein involved in phosphoinositide met... 27 1.1 SPBC3H7.02 |||sulfate transporter |Schizosaccharomyces pombe|chr... 26 2.4 SPBC646.04 |pla1||poly|Schizosaccharomyces pombe|chr 2|||Manual 26 2.4 SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|... 26 2.4 SPAC644.06c |cdr1|nim1|GIN4 family protein kinase Cdr1|Schizosac... 26 2.4 SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Sc... 25 3.2 SPBC1709.11c |png2||ING family homolog Png2|Schizosaccharomyces ... 25 3.2 SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr ... 25 4.3 SPBC3B8.05 |||diphthamide biosynthesis protein |Schizosaccharomy... 25 4.3 SPBC4C3.12 |sep1||fork head transcription factor Sep1|Schizosacc... 25 4.3 SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyce... 25 5.6 SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces... 25 5.6 SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharom... 25 5.6 SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces ... 25 5.6 SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces ... 24 7.4 SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual 24 7.4 SPAC2F7.03c |pom1||DYRK family protein kinase Pom1|Schizosacchar... 24 7.4 SPAC1782.05 |||phosphotyrosyl phosphatase activator homolog|Schi... 24 7.4 SPAC17G6.10 |ssr1||SWI/SNF and RSC complex subunit Ssr1|Schizosa... 24 9.8 SPAC821.05 |||translation initiation factor eIF3h|Schizosaccharo... 24 9.8 SPBC20F10.10 |||cyclin pho85 family|Schizosaccharomyces pombe|ch... 24 9.8 >SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1|Schizosaccharomyces pombe|chr 2|||Manual Length = 775 Score = 28.7 bits (61), Expect = 0.35 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = +1 Query: 58 YEFVTPLTSLVVVKPNE--TNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLP 231 Y + + + +V+ N+ T+ + E ++PA +++ S+P Y IS+ R T+ L SLP Sbjct: 483 YGHTSTIRCIKIVQGNQSTTDTDDVEKENRPASNDAN--SMPPYIISSSRDCTIRLWSLP 540 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 27.5 bits (58), Expect = 0.80 Identities = 13/46 (28%), Positives = 26/46 (56%) Frame = +1 Query: 58 YEFVTPLTSLVVVKPNETNAVNAESVDKPAFQESSFASVPVYDISN 195 Y F+T L+ ++++ +E + + +++P S VPVY IS+ Sbjct: 558 YRFLTQLSKSLLMEISEEDEIYLYELERPYEDGSDDILVPVYHISD 603 >SPBC25H2.03 |||vacuolar protein involved in phosphoinositide metabolism|Schizosaccharomyces pombe|chr 2|||Manual Length = 811 Score = 27.1 bits (57), Expect = 1.1 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -2 Query: 178 QGPMQTKILEKPVYQQIPRSLHSFHLVSLLPKTSE 74 +GP+ + I + PV +H+F L L+P SE Sbjct: 177 EGPVSSSIQDVPVMSTEQPRMHTFSLSELVPLLSE 211 >SPBC3H7.02 |||sulfate transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 877 Score = 25.8 bits (54), Expect = 2.4 Identities = 20/71 (28%), Positives = 33/71 (46%), Gaps = 4/71 (5%) Frame = +1 Query: 52 LKYEFVTPLTSLVVVKPNETNAVNAESVDKPAFQESSFASVPVYDI----SNVRPGTVAL 219 L Y+F+ +T VV P + ++ SSF V +Y I +V G VA+ Sbjct: 134 LVYDFIAGITVGCVVVPQGMSYAKVATLPAQYGLYSSFVGVAIYCIFATSKDVSIGPVAV 193 Query: 220 QSLPSPQLTAD 252 SL + ++ A+ Sbjct: 194 MSLVTSKVIAN 204 >SPBC646.04 |pla1||poly|Schizosaccharomyces pombe|chr 2|||Manual Length = 566 Score = 25.8 bits (54), Expect = 2.4 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 242 NCGLGSDCRATVPGLTLEISYTGTD 168 NC + + G+TLE++Y TD Sbjct: 412 NCSSEEEAQQVASGVTLEVAYESTD 436 >SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 25.8 bits (54), Expect = 2.4 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 223 SLPSPQLTADTSYQYQPLSIPQHFSMARPQLASFSSYADVSD 348 SLP+P Y QP+S+PQ + P A SS + +SD Sbjct: 168 SLPTPY---PVQYSTQPVSLPQPIAAPAPPSAE-SSKSTISD 205 >SPAC644.06c |cdr1|nim1|GIN4 family protein kinase Cdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 593 Score = 25.8 bits (54), Expect = 2.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 181 YDISNVRPGTVALQSLPSPQL 243 Y NVR ++ LQSLP+P L Sbjct: 443 YSTDNVRTDSLDLQSLPTPTL 463 >SPBC29A10.04 |psm1|smc1|mitotic cohesin complex subunit Psm1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1233 Score = 25.4 bits (53), Expect = 3.2 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 127 ESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPS 234 E +D P +E S S+P+ D+SN G + + PS Sbjct: 941 EDIDVP-LREGSLTSIPIDDVSN--SGDITMGEEPS 973 >SPBC1709.11c |png2||ING family homolog Png2|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 25.4 bits (53), Expect = 3.2 Identities = 17/82 (20%), Positives = 36/82 (43%) Frame = +1 Query: 88 VVVKPNETNAVNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTSYQY 267 VV+K + + ++ E ++ + + + Y S + T A+ ++ S D ++Y Sbjct: 53 VVLKNEKNDELSGE--ERCERLQKTLKEILPYSDSKICLATDAMNNIKSCIDRLDAGFEY 110 Query: 268 QPLSIPQHFSMARPQLASFSSY 333 L IPQ + P + +Y Sbjct: 111 VELEIPQQLRLGYPDDRALMNY 132 >SPAC26F1.08c |||conserved protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.0 bits (52), Expect = 4.3 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = -3 Query: 213 YGSWSNVGNIIYRDRCKRRFLKSRFINRFRVHCIRFI 103 Y + V NI + +LK+ I+ F + CIRFI Sbjct: 682 YSGIATVFNITFPPILYGSYLKTSTISPFHLACIRFI 718 >SPBC3B8.05 |||diphthamide biosynthesis protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 436 Score = 25.0 bits (52), Expect = 4.3 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 373 HHNFQIQPCLRHQRTRRMKRVAV 305 ++NF+I + H R R+ KRVA+ Sbjct: 72 NYNFEIHKTIWHIRLRKAKRVAL 94 >SPBC4C3.12 |sep1||fork head transcription factor Sep1|Schizosaccharomyces pombe|chr 2|||Manual Length = 663 Score = 25.0 bits (52), Expect = 4.3 Identities = 12/47 (25%), Positives = 24/47 (51%) Frame = +1 Query: 118 VNAESVDKPAFQESSFASVPVYDISNVRPGTVALQSLPSPQLTADTS 258 V+ +D P+ E+ F+ + V + +V + + PSP L++ S Sbjct: 297 VDTPGIDAPSDLEAKFSDLGVSSVVSVTSPLQSCTNSPSPPLSSPAS 343 >SPBC32H8.02c |nep2|mug120|nedd8 protease Nep2|Schizosaccharomyces pombe|chr 2|||Manual Length = 415 Score = 24.6 bits (51), Expect = 5.6 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 226 LPSPQLTADTSYQYQPLSIPQHFSMARPQLASFS 327 L P L+A TS QP S+P ++PQ S S Sbjct: 313 LELPTLSAVTSDSAQPHSLPASMPSSQPQSRSES 346 >SPAC12G12.03 |cip2||RNA-binding protein Cip2|Schizosaccharomyces pombe|chr 1|||Manual Length = 576 Score = 24.6 bits (51), Expect = 5.6 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 49 ALKYEFVTPLTSLVVVKPNETNAVNAESVDKPAFQESSFASV 174 A E TP +L V P + NA N+ + + FAS+ Sbjct: 519 ATPLELATPFANLNVSSPLDRNATNSSNTLNGSAMNDYFASL 560 >SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 24.6 bits (51), Expect = 5.6 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +2 Query: 221 NHSQVRN*PQILRTNTNHYLYL 286 NH QV N P++LRT+ + ++L Sbjct: 512 NHLQVCNLPELLRTSNSFGIWL 533 >SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces pombe|chr 3|||Manual Length = 1364 Score = 24.6 bits (51), Expect = 5.6 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = +1 Query: 268 QPLSIPQHFS-MARPQLASFSSYADV 342 +P+ IPQHFS +ARP L S + D+ Sbjct: 339 RPIEIPQHFSPIARP-LTSQEAIVDM 363 >SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 24.2 bits (50), Expect = 7.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 146 LFKNLRLHRSLYMIFPTLDQEP*LCNHSQVR 238 L K L+ HR Y+IF Q NH+ ++ Sbjct: 88 LLKELKKHRDSYVIFDCPGQVELFTNHNSLQ 118 >SPAC18B11.05 |gpi18||pig-V|Schizosaccharomyces pombe|chr 1|||Manual Length = 426 Score = 24.2 bits (50), Expect = 7.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 156 FLKSRFINRFRVHCIRFIWFHY 91 + KSR + F HCI F+W Y Sbjct: 391 YAKSRNLKAFG-HCILFVWIVY 411 >SPAC2F7.03c |pom1||DYRK family protein kinase Pom1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1087 Score = 24.2 bits (50), Expect = 7.4 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = -2 Query: 235 DLGVIAELRFLV*RWKYHIQGPMQTKILEK 146 + G + L+ + + ++H+Q ++TKIL+K Sbjct: 720 ETGKLVALKIIRNKKRFHMQALVETKILQK 749 >SPAC1782.05 |||phosphotyrosyl phosphatase activator homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 352 Score = 24.2 bits (50), Expect = 7.4 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = -2 Query: 157 ILEKPVYQQIPRSLHSFHLVSLLPKTSEV*Q 65 + +KP+ IP+S H++++L + E+ Q Sbjct: 46 VKDKPISASIPQSSSIEHVLNILDRVGEIKQ 76 >SPAC17G6.10 |ssr1||SWI/SNF and RSC complex subunit Ssr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 23.8 bits (49), Expect = 9.8 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Frame = +1 Query: 181 YDIS-NVRPGTVALQSLPSPQLTADTSYQYQPLSIPQHFSMARPQLASFSSYADVSDRVE 357 Y+++ + RP + S Q+ ADT PL P S+ R + + + V + Sbjct: 140 YNVNPDTRPSKIGPPSTSHFQILADTPRGLVPLLPPPSSSIPRSKAVTIEDPSIVRTNIY 199 Query: 358 FESYDD 375 S DD Sbjct: 200 DPSLDD 205 >SPAC821.05 |||translation initiation factor eIF3h|Schizosaccharomyces pombe|chr 1|||Manual Length = 357 Score = 23.8 bits (49), Expect = 9.8 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -2 Query: 142 VYQQIPRSLHSFHLVSLLPKTSEV*QIHTSELTLKLSFQDC 20 V +++P +H+ HL + L + S LT + + +DC Sbjct: 186 VIRELPIVIHNSHLATCLLHSLSEPPTPASTLTAEAALEDC 226 >SPBC20F10.10 |||cyclin pho85 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 243 Score = 23.8 bits (49), Expect = 9.8 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 186 IIYRDRCKRRFLKSRFINRFRVH 118 +IY DR F + FIN F +H Sbjct: 104 LIYLDRIVHHFHFTVFINSFNIH 126 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.312 0.126 0.348 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,482,486 Number of Sequences: 5004 Number of extensions: 28863 Number of successful extensions: 82 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 132093910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -