BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_P01 (549 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1 |Sc... 27 1.4 SPBC16H5.02 |pfk1||6-phosphofructokinase |Schizosaccharomyces po... 26 3.2 SPAC1D4.02c |||human GRASP protein homolog |Schizosaccharomyces ... 25 5.6 SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces ... 25 7.3 SPAC644.12 |cdc5||cell division control protein Cdc5|Schizosacch... 25 7.3 SPBC31F10.09c |nut2|med10|mediator complex subunit Med10|Schizos... 25 9.7 SPAC17A2.03c |vma6||V-type ATPase subunit d|Schizosaccharomyces ... 25 9.7 SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ... 25 9.7 >SPBC1347.01c |rev1|SPBC215.16c|deoxycytidyl transferase Rev1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 935 Score = 27.5 bits (58), Expect = 1.4 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 118 VSLKFVHTLRLESVSYGHSLMQLQIAS 38 VS +F H LRL+ V+ H + +IAS Sbjct: 291 VSTRFSHELRLKPVAVAHGIKNSEIAS 317 >SPBC16H5.02 |pfk1||6-phosphofructokinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 942 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 170 LGAVPRGAVPPRADRVLRDLQG 235 LG V RG +P DR+L LQG Sbjct: 476 LGHVQRGGIPCAYDRMLATLQG 497 >SPAC1D4.02c |||human GRASP protein homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 25.4 bits (53), Expect = 5.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 531 HWSRNGAMQCSQGH 490 HW NGA+ C GH Sbjct: 191 HWGGNGAIGCGVGH 204 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 119 GLVEVCAHLAPRVGFVWTLLDAVADS 42 G+V A +AP V +W +L+ + DS Sbjct: 104 GMVLQWASIAPAVDAIWHILNVIDDS 129 >SPCC4G3.14 |mdj1||DNAJ domain protein Mdj1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 528 Score = 25.0 bits (52), Expect = 7.3 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +1 Query: 1 AAPAVSVRSTSTGKLSATASRSVHTKPTLGARCAQTSTRPG 123 ++P+ + STST S+ S + T+PT G Q + G Sbjct: 464 SSPSGTNSSTSTSSTSSKHSTGISTEPTTGEENKQDGSVGG 504 >SPAC644.12 |cdc5||cell division control protein Cdc5|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 25.0 bits (52), Expect = 7.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 201 GGTAPRGTAPSGRGRGSAVGTPRSPMTRS 115 GGT G PS GSA+ P++ R+ Sbjct: 409 GGTGYTGVTPSHAANGSALAAPQATPFRT 437 >SPBC31F10.09c |nut2|med10|mediator complex subunit Med10|Schizosaccharomyces pombe|chr 2|||Manual Length = 138 Score = 24.6 bits (51), Expect = 9.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +2 Query: 182 PRGAVPPRADRVLRDLQGNAGVQRERNVRLP 274 P A+P D ++RDL+ + R+ N +P Sbjct: 34 PSDAIPESLDTLIRDLKSLPDISRKVNNLIP 64 >SPAC17A2.03c |vma6||V-type ATPase subunit d|Schizosaccharomyces pombe|chr 1|||Manual Length = 343 Score = 24.6 bits (51), Expect = 9.7 Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 10/74 (13%) Frame = +3 Query: 72 YETDSRRKVCTNFNETWS-----SDCEVYRQRCLCLD-----HSELCRGAQYHHVQIEYY 221 +ET V TN E +S + Y + CL D H E+ R Y ++Y Sbjct: 131 FETLPALCVATNVEELYSVVLIETPLAPYFKDCLSADDLDEQHIEIIRNTLYKAYLEDFY 190 Query: 222 GTCREMPECSENEM 263 C+++ C+ + M Sbjct: 191 NFCKKIGACTADTM 204 >SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 422 Score = 24.6 bits (51), Expect = 9.7 Identities = 16/56 (28%), Positives = 21/56 (37%) Frame = -1 Query: 294 ASRACAAGSLTFRSRCTPAFPCKSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRSP 127 AS A S + S P S + S+RG T T P RG + +P Sbjct: 264 ASSTIAEVSPMYGSHAAPYASTPSAAVGSSRGSTPASATVPISPARGFPTTSAYNP 319 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,094,586 Number of Sequences: 5004 Number of extensions: 39768 Number of successful extensions: 140 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 136 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -