BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_P01 (549 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase... 29 0.076 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 27 0.41 AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase... 27 0.41 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 26 0.71 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 24 2.9 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 2.9 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 24 2.9 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 24 3.8 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 3.8 AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. 23 5.0 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 23 6.6 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 23 6.6 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 6.6 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.6 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 23 8.8 AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-tran... 23 8.8 >AF063021-3|AAC16247.1| 484|Anopheles gambiae dopa decarboxylase isoform 2 protein. Length = 484 Score = 29.5 bits (63), Expect = 0.076 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +3 Query: 228 CREMPECSENEMSDFPRRMRDWLFNIMRDLAERREL---TPHYLR 353 C E E DF + M D++ N + ++ +RR L P YLR Sbjct: 5 CETRTEMQAPEFKDFAKEMVDYISNYLENIRDRRVLPTVQPGYLR 49 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 27.1 bits (57), Expect = 0.41 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 4/51 (7%) Frame = -1 Query: 255 SRCTPAFPCKSRSTRSARGG----TAPRGTAPSGRGRGSAVGTPRSPMTRS 115 S C+P S S S+ G T+P + +G S+VG P +P S Sbjct: 236 SSCSPLSTASSASCSSSAAGSLCPTSPPASVSNGEQPASSVGDPANPQQPS 286 >AF063021-2|AAC16249.1| 515|Anopheles gambiae dopa decarboxylase isoform 1 protein. Length = 515 Score = 27.1 bits (57), Expect = 0.41 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = +3 Query: 243 ECSENEMSDFPRRMRDWLFNIMRDLAERREL---TPHYLR 353 E E DF + M D++ N + ++ +RR L P YLR Sbjct: 41 EMQAPEFKDFAKEMVDYISNYLENIRDRRVLPTVQPGYLR 80 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 26.2 bits (55), Expect = 0.71 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -1 Query: 303 C*TASRACAAGSLTFRSRCTPAFPCKSRST 214 C T C+ LTF +C P P S T Sbjct: 101 CLTHMECCSGNCLTFSYKCVPLSPSDSAMT 130 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +3 Query: 99 CTNFNETWSSDCEVYRQRCL 158 CT SS+C YR +C+ Sbjct: 315 CTRHENCCSSNCHSYRGKCV 334 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 24.2 bits (50), Expect = 2.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -1 Query: 204 RGGTAPRGTAPSGRGRGSAVG 142 RGG PRGT + G G G Sbjct: 258 RGGNYPRGTERNRNGNGYGAG 278 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.2 bits (50), Expect = 2.9 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -1 Query: 228 KSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRSPMTRSR 112 +SRS + G+ R + SG GS G+ +RSR Sbjct: 1064 RSRSRSRSGSGSRSRSRSGSGSRAGSRAGSGSRSRSRSR 1102 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 24.2 bits (50), Expect = 2.9 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 234 PCKSRSTRSARGGTAPRGTAPSGRGRGSAVGTPRS 130 P +S A GG P + +GR +A G P S Sbjct: 67 PGRSHPAEPAPGGNGPFVRPDAPQGRSAAEGVPSS 101 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 23.8 bits (49), Expect = 3.8 Identities = 6/22 (27%), Positives = 13/22 (59%) Frame = +3 Query: 18 CEINEHGEAICNCIKECPYETD 83 C +H + +C+ +++CP D Sbjct: 26 CRTPDHRDGVCHPVQQCPSVRD 47 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.8 bits (49), Expect = 3.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -3 Query: 403 PALVQRRVRLDSASRSMRR 347 PAL RRV+L +RS +R Sbjct: 209 PALAARRVKLSQRNRSQQR 227 >AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. Length = 196 Score = 23.4 bits (48), Expect = 5.0 Identities = 21/60 (35%), Positives = 23/60 (38%), Gaps = 7/60 (11%) Frame = -2 Query: 473 GNNSCRD-TNLSLSCASRSH------HFPDAGVGPAPGQVGLGLALHAQVVGGELAPLGQ 315 G N +D L LSC S F AGV P G A+ GGE P GQ Sbjct: 29 GRNVYKDYKQLELSCESTDDVDSWKASFLRAGVYPEKDTPANGDETEAEESGGESGPTGQ 88 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 23.0 bits (47), Expect = 6.6 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = -3 Query: 145 RYTSQSDDQVSLKFVHTLRLESVSYGHSLMQLQIASPCSLISQTRPAL 2 +Y+ D S VH+ RL + Y ++ ++ A+P PA+ Sbjct: 54 QYSKAVDSAHSSVRVHSSRLSNDGYAYAAPAVKYAAPAYAAHYAAPAV 101 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 265 DISFSLHSGISLQVP*YSI 209 D S +LH G+ + +P Y+I Sbjct: 396 DTSVTLHPGMKIMIPAYAI 414 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.0 bits (47), Expect = 6.6 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -2 Query: 515 ARCSAPRDMSGARIGNNSCRDTNLSLSCASRSHHFPDA 402 +R S+ R + GNNS S + HH P A Sbjct: 804 SRNSSERMLPSGATGNNSTNSAYSMQSHQQQQHHQPSA 841 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 6.6 Identities = 10/41 (24%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +3 Query: 15 VCEINEHGEAICNCIK--ECPYETDSRRKVCTNFNETWSSD 131 +C N H A+C+C + C E + +WS++ Sbjct: 769 LCSYNTHCFALCHCCEFDACDCEMTCPNNCACYHDNSWSTN 809 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +3 Query: 453 IPARVVPDPGAAHV 494 +PA+V+PD AA+V Sbjct: 42 LPAKVIPDKTAAYV 55 >AF515524-1|AAM61891.1| 218|Anopheles gambiae glutathione S-transferase u3 protein. Length = 218 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 216 YYGTCREMPECSENE 260 +Y CRE+P ENE Sbjct: 186 WYERCRELPGFDENE 200 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,386 Number of Sequences: 2352 Number of extensions: 11639 Number of successful extensions: 47 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -