BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O24 (563 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 25 1.3 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 25 1.7 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 25 1.7 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 25 1.7 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 25 1.7 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 25 2.3 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 25 2.3 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 25 2.3 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 24 3.0 AJ404478-1|CAC16182.1| 77|Anopheles gambiae putative GATA fact... 24 3.0 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 3.9 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 24 3.9 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 3.9 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 9.1 AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-h... 23 9.1 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 23 9.1 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 25.4 bits (53), Expect = 1.3 Identities = 13/59 (22%), Positives = 22/59 (37%) Frame = +3 Query: 213 GWGVRVWRDVTADAAEQSTARADAEAMRYLSMLLYPLCIAGAVYSLIYEPHKSWYSWAL 389 GW ++ + + Q+ + L +L C A Y P+KS + W L Sbjct: 221 GWSIKYFSKDIFEVMMQAAVDTEVTTSEDLMRILVTACNATMTKRKRYTPNKSAFWWTL 279 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 46 NHPIRKYIILKDLPDAVRVQLLARRR 71 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 46 NHPIRKYIILKDLPDAVRVQLLARRR 71 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 25.0 bits (52), Expect = 1.7 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -3 Query: 150 SHPVRGLIVMSVRPEDKRI*SVARRR 73 +HP+R I++ P+ R+ +ARRR Sbjct: 57 NHPIRKYIILKDLPDAVRVQLLARRR 82 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 360 PHKSWYSWALRSTVNGVYAFGFLFML 437 P KSWY W S Y F F++ + Sbjct: 178 PIKSWYPWNAMS--GPAYIFSFIYQI 201 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 360 PHKSWYSWALRSTVNGVYAFGFLFML 437 P KSWY W S Y F F++ + Sbjct: 31 PIKSWYPWNAMS--GPAYIFSFIYQI 54 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 360 PHKSWYSWALRSTVNGVYAFGFLFML 437 P KSWY W S Y F F++ + Sbjct: 178 PIKSWYPWNAMS--GPAYIFSFIYQI 201 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 24.2 bits (50), Expect = 3.0 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 202 TRKCNTFVTFHNSITALIPPG 140 +R CN FH S IPPG Sbjct: 366 SRNCNHHHGFHPSTVCKIPPG 386 >AJ404478-1|CAC16182.1| 77|Anopheles gambiae putative GATA factor protein. Length = 77 Score = 24.2 bits (50), Expect = 3.0 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = -2 Query: 265 LCSAASAVTSRHTRTPHPPNATRKCNTFV 179 LC+A + T ++ T PPN ++K V Sbjct: 18 LCNACALYTRQNPGTNRPPNRSQKAKQTV 46 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.8 bits (49), Expect = 3.9 Identities = 12/44 (27%), Positives = 24/44 (54%) Frame = +3 Query: 300 LSMLLYPLCIAGAVYSLIYEPHKSWYSWALRSTVNGVYAFGFLF 431 L L YP+ A + ++LIY+ +K+ +++ + V F F + Sbjct: 2078 LHSLRYPMDSAASSFTLIYDYNKNGEVKSIKESTKRVPMFEFSY 2121 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 129 LVLVPGGISAVIELWKVTKVLHLRVAFGGWGVR 227 +++V +SAV+ L V V+H+R + W R Sbjct: 1 MLIVAWLLSAVLSLCFVLCVIHIRKKYSFWSER 33 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.8 bits (49), Expect = 3.9 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 208 SAGGECACGVTSQRTRPN 261 S G+C CGV RPN Sbjct: 561 SGRGQCVCGVCVCERRPN 578 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 244 QRTRPNRVRRAPTPRR 291 Q RP RVRRAP R Sbjct: 164 QPARPYRVRRAPRAER 179 >AF395079-1|AAK97461.1| 371|Anopheles gambiae basic helix-loop-helix transcriptionfactor ASH protein. Length = 371 Score = 22.6 bits (46), Expect = 9.1 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = -2 Query: 265 LCSAASAVTSRHTRTPHPPNATRKCNTFVTFHNS 164 LCSA+S ++ + P NA+ + ++ H+S Sbjct: 197 LCSASSGSSTYYGTMSEPSNASSPAPSHLSDHSS 230 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 22.6 bits (46), Expect = 9.1 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 127 SDVCSSRR*KNIISCEKARQKTVRADKPAKDLLRRQK 17 S + SS R N SC + +D+P +L++Q+ Sbjct: 42 SSISSSSR--NSSSCNNSSSSGTHSDRPVAGMLQQQQ 76 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 553,969 Number of Sequences: 2352 Number of extensions: 10340 Number of successful extensions: 74 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52983882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -