BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O19 (448 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 28 3.1 SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_21821| Best HMM Match : MRG (HMM E-Value=0) 28 4.0 SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) 27 9.3 SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11) 27 9.3 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_26296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 86 ALLILGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRP 220 A +I GF+ + C +RY Q+ N +N W+ S NRP Sbjct: 6 ATIIRGFLKFRIICEKVRYFTQLRACYN--PQQNKWDTSHTNNRP 48 >SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) Length = 997 Score = 28.3 bits (60), Expect = 3.1 Identities = 24/68 (35%), Positives = 31/68 (45%) Frame = +2 Query: 98 LGFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIPIQNGYRIQYPLDNNY 277 LG I SQA NIR Q N +L + N + P+Q GY+ PL +NY Sbjct: 612 LGQITSQAIGSNIR---QDVANVSLPLQMPISNPKTSVPQGGATPMQFGYQGYGPLQHNY 668 Query: 278 NFIAFIFP 301 + IFP Sbjct: 669 GDMNTIFP 676 >SB_16461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 28.3 bits (60), Expect = 3.1 Identities = 9/37 (24%), Positives = 22/37 (59%), Gaps = 4/37 (10%) Frame = +3 Query: 9 LYLYLCYKICHINYFYY----YNLKWISCARFLYWVL 107 ++L+ +CH+NY Y+ +++ W+ ++Y V+ Sbjct: 121 IWLFHVSLLCHVNYMYHVIWLFHVSWLCHVNYMYHVI 157 >SB_21821| Best HMM Match : MRG (HMM E-Value=0) Length = 292 Score = 27.9 bits (59), Expect = 4.0 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 101 GFIASQATCMNIRYKRQIENNANLFIDKNGWNKSQDGNRPEWIP 232 G + +A C+ + K E A I NGWNK+ D EW+P Sbjct: 18 GPLIYEAKCIRGQLK---EKTARYLIHYNGWNKNWD----EWVP 54 >SB_41585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 351 HQLLALVEHHDKQLRNARRIAFQHQNTSPC 440 H L AL +++R RRI+++ QNT C Sbjct: 84 HSLPALTFESARKVRQYRRISWEGQNTQTC 113 >SB_59196| Best HMM Match : DUF593 (HMM E-Value=1.7) Length = 1376 Score = 26.6 bits (56), Expect = 9.3 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 398 CAENCISTPEYKPVC 442 C +CISTP Y +C Sbjct: 1196 CVHSCISTPRYDQIC 1210 >SB_40027| Best HMM Match : RVT_1 (HMM E-Value=3.8e-11) Length = 587 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 235 NWDPFGTVPVLRFVPSVLVNK*IRVVFYLPFVS 137 +W P VP+ + P V VNK +R + P +S Sbjct: 276 SWKPADVVPLPKLKPVVDVNKHLRPISLTPAIS 308 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 26.6 bits (56), Expect = 9.3 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +2 Query: 209 GNRPEWIPIQNGYRIQYPLDNNYNFIAFIFPN 304 G+R ++ IQNG + ++ + + ++FPN Sbjct: 1122 GSRDSFVAIQNGRQWMLDIEESISIAFYVFPN 1153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,694,922 Number of Sequences: 59808 Number of extensions: 297389 Number of successful extensions: 732 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -