BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O15 (333 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 26 1.7 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 25 2.3 SPCC1795.08c |||histone acetyltransferase complex subunit |Schiz... 25 2.3 SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|c... 25 3.0 SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protei... 25 4.0 SPAC9G1.05 |||actin cortical patch component Aip1 |Schizosacchar... 25 4.0 SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|S... 23 9.2 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 25.8 bits (54), Expect = 1.7 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 213 IYHMGEIYNCSLSASSAHYATATVAILSRVVWTTVPED 326 I+H +C L ASS ++ + +L+RV+W +D Sbjct: 2943 IHHACNAVSCFLQASSLLSSSNSKPLLTRVLWLLSVDD 2980 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 25.4 bits (53), Expect = 2.3 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +3 Query: 207 STIYHMGEIYNCSLSASSAHYATATVAILS--RVVWTT 314 S IYHM +CSL +A+Y + + +S + WT+ Sbjct: 1947 SQIYHMSPEESCSLPIETAYYYSIHIRPVSEFKFNWTS 1984 >SPCC1795.08c |||histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 985 Score = 25.4 bits (53), Expect = 2.3 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -1 Query: 330 PNPPGPSSILPETKWLP 280 P PP I PE WLP Sbjct: 698 PYPPSSKDIRPEAPWLP 714 >SPBC1773.12 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 25.0 bits (52), Expect = 3.0 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +3 Query: 228 EIYNCSLSASSAHYATATVAILSR-VVW-TTVPEDL 329 +IY C SAS Y A ++I + +VW +P++L Sbjct: 389 KIYKCLASASEEVYKEAVLSIRGKLIVWERNLPDEL 424 >SPAC3G9.12 |peg1|cls1|CLASP family microtubule-associated protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1462 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = -1 Query: 309 SILPETKWLPSRSHSARKTPTVN 241 ++LP+ KW+ SR H +N Sbjct: 1202 NVLPKNKWILSRMHKMENGSPIN 1224 Score = 24.6 bits (51), Expect = 4.0 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 46 SILPETKWLPSRSHSARKTPTVN 114 ++LP+ KW+ SR H +N Sbjct: 1202 NVLPKNKWILSRMHKMENGSPIN 1224 >SPAC9G1.05 |||actin cortical patch component Aip1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 595 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 216 YHMGEIYNCSLSASSAHYATATV 284 +H G I S +A S H ATA++ Sbjct: 520 FHTGRILGMSWNAKSTHLATASL 542 >SPAC4G9.17c |mrps5||mitochondrial ribosomal protein subunit S5|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 23.4 bits (48), Expect = 9.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 42 RPGGFGLRC 16 RP GFGLRC Sbjct: 314 RPAGFGLRC 322 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,248,000 Number of Sequences: 5004 Number of extensions: 19973 Number of successful extensions: 53 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 93942212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -