BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O15 (333 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0116 - 15440263-15441024,15441097-15443451 26 6.4 >02_03_0116 - 15440263-15441024,15441097-15443451 Length = 1038 Score = 26.2 bits (55), Expect = 6.4 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +1 Query: 7 EGSATQTKSSGPSSILPETKWLPSRSHSARKTPTVNN 117 EG++ T+ P+S + PSR H K TV+N Sbjct: 443 EGASRATRKGRPASDKKKEAGAPSREHPTGKWCTVHN 479 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,921,652 Number of Sequences: 37544 Number of extensions: 125713 Number of successful extensions: 337 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 336 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 459426840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -