BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O13 (583 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_1023 - 22341815-22342042,22342179-22342247,22342717-223428... 28 4.7 07_01_0652 + 4895366-4895483,4895661-4896262 28 6.2 >10_08_1023 - 22341815-22342042,22342179-22342247,22342717-22342840, 22343193-22343317,22343815-22344276,22344357-22344700, 22345061-22345406,22345492-22345941,22346760-22347051, 22347171-22347515,22347611-22347834,22348072-22348563, 22348664-22349056,22349601-22349741,22349845-22350207, 22350494-22352683,22353298-22353360,22353434-22353535, 22353672-22354027,22354326-22354413,22354517-22354750, 22355508-22355975 Length = 2632 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 115 TVTAWDFFKELEGVGQRVRDAIISAGPAIDVLQKAKDIADGR 240 ++ A + K + G G R RDA+++ G + +++ I D R Sbjct: 2466 SILALETLKRVVGAGNRARDALVAQGLKVGLVEVLLGILDWR 2507 >07_01_0652 + 4895366-4895483,4895661-4896262 Length = 239 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -3 Query: 554 NKICNKYYSYNNNLNINTGMARLFCTIYN 468 N+ICN Y+ NN N++ A + +++ Sbjct: 187 NQICNSYFGLNNGNNVSGTAASILLDVFH 215 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,308,854 Number of Sequences: 37544 Number of extensions: 187432 Number of successful extensions: 345 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 345 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1364465340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -