BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O09 (450 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0695 + 5251802-5253016 27 7.0 01_06_1795 - 39925019-39926029,39926265-39926408,39927200-399272... 27 7.0 03_05_0135 + 21154421-21154703,21154985-21155103,21155228-211554... 27 9.2 >07_01_0695 + 5251802-5253016 Length = 404 Score = 27.1 bits (57), Expect = 7.0 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = +1 Query: 97 DLNGLLGTTYAVYFWPPNQRQREDCEVINFKKLNSQEVYQAGNNCYRLNLSSEQSIV 267 DLNG L +AVY P + D E + K S + NN Y L L ++ IV Sbjct: 302 DLNGSLVMVHAVYGSPMDLWFLSDLEQGLWVKKYSIDFEYYNNNAYPLLLLDDEKIV 358 >01_06_1795 - 39925019-39926029,39926265-39926408,39927200-39927277, 39927722-39927838,39927925-39927981,39928492-39928623, 39928725-39928922,39929364-39929474,39929570-39929785, 39929879-39930064,39930590-39931192 Length = 950 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -1 Query: 450 ANSTPRPPEEQLIPS 406 AN+TP+P +EQ+IPS Sbjct: 819 ANATPQPAKEQVIPS 833 >03_05_0135 + 21154421-21154703,21154985-21155103,21155228-21155458, 21155779-21156028,21157496-21157716 Length = 367 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 374 YLFITINENYVLGINCSSGGRGV 442 YL I+ Y+ G+N SSGG GV Sbjct: 106 YLSISNTSVYLRGVNFSSGGSGV 128 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,404,878 Number of Sequences: 37544 Number of extensions: 216947 Number of successful extensions: 429 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -