BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O08 (439 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 6.8 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 20 9.0 AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochr... 20 9.0 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 20.6 bits (41), Expect = 6.8 Identities = 16/71 (22%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Frame = +1 Query: 112 VIKITECVICVENFNYHFYKICLKRSRALHRRSNTIDYCCTTTSQLACTHHHRPRSSRTV 291 ++ + + C+ NFN+ L ++++ + YC T L+ S Sbjct: 15 IVFVQSEIFCLVNFNHRESYFRLSKAKSFCTFVAALVYCSVTFFALSELLTDLATSILLK 74 Query: 292 LISLTI-FCSS 321 + SL I FC+S Sbjct: 75 VSSLLIGFCAS 85 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 20.2 bits (40), Expect = 9.0 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 344 EYFLQLAGGKGG 379 E FL +GGKGG Sbjct: 130 EDFLACSGGKGG 141 >AF265298-1|AAG17641.1| 124|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 124 Score = 20.2 bits (40), Expect = 9.0 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = +3 Query: 201 PKIEYNRLLLHDDQSASLYPPSPPEIKPNR 290 PK + L ++ Y P P + PNR Sbjct: 80 PKDTFLSLFIYGMHHNEKYFPEPEKFDPNR 109 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,197 Number of Sequences: 336 Number of extensions: 2245 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9775509 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -