BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O08 (439 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29536-2|AAA68790.1| 759|Caenorhabditis elegans Brf (transcript... 28 2.6 Z81477-7|CAB03927.2| 326|Caenorhabditis elegans Hypothetical pr... 28 3.4 AL022288-7|CAA18369.1| 326|Caenorhabditis elegans Hypothetical ... 28 3.4 Z72515-1|CAA96681.1| 419|Caenorhabditis elegans Hypothetical pr... 27 4.5 >U29536-2|AAA68790.1| 759|Caenorhabditis elegans Brf (transcription factor) homologprotein 1 protein. Length = 759 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 148 NFNYHFYKICLKRSRALHR-RSNTIDYCCTTTSQLACTHH 264 N ++FYK+C+ R+ R RS+ + C T +L T H Sbjct: 103 NTAFNFYKMCVSRNLTRGRNRSSVVAVCMYITCRLENTAH 142 >Z81477-7|CAB03927.2| 326|Caenorhabditis elegans Hypothetical protein C27C7.4 protein. Length = 326 Score = 27.9 bits (59), Expect = 3.4 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +1 Query: 118 KITECVIC--VENFNYHFYKICLKRSRALHRRSNTIDYCCTTTSQLACTH 261 +I C +C E +F A RRS+ I Y CT T+ +H Sbjct: 11 EIASCQVCHSTERTRLYFGITSCAACAAFFRRSDGIRYMCTATNSCTISH 60 >AL022288-7|CAA18369.1| 326|Caenorhabditis elegans Hypothetical protein ZK1025.10 protein. Length = 326 Score = 27.9 bits (59), Expect = 3.4 Identities = 15/50 (30%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +1 Query: 118 KITECVIC--VENFNYHFYKICLKRSRALHRRSNTIDYCCTTTSQLACTH 261 +I C +C E +F A RRS+ I Y CT T+ +H Sbjct: 11 EIASCQVCHSTERTRLYFGITSCAACAAFFRRSDGIRYMCTATNSCTISH 60 >Z72515-1|CAA96681.1| 419|Caenorhabditis elegans Hypothetical protein T11A5.1 protein. Length = 419 Score = 27.5 bits (58), Expect = 4.5 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +1 Query: 100 RKCV-VIKITECVICVENFNYHFYKI-CLKRSRALHRRSNTIDYCCTTTSQLACTHHHRP 273 R C+ V+ + +C + Y I C+ + HRR NTID T T + A H P Sbjct: 304 RSCIPVLSHQDMPLCFVCYLYRLRTISCVAAKKYPHRRPNTID---TYTQRHAYRHFLFP 360 Query: 274 RSSRTVLI 297 R +I Sbjct: 361 RIKNIKII 368 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,645,334 Number of Sequences: 27780 Number of extensions: 206699 Number of successful extensions: 668 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 652 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 745968860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -