BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O05 (614 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein ... 24 3.4 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 24 4.5 >CR954256-7|CAJ14148.1| 1087|Anopheles gambiae predicted protein protein. Length = 1087 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +1 Query: 1 DYTFNPKMRIILILLVSLGLCHADDIAQAAGQIFNSILPNL 123 ++ F+P ++ I + + LC D A Q S P L Sbjct: 889 EFEFDPARTVLEICRIYVNLCECDAFCLAVSQDGRSYSPQL 929 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 483 QTRIRHAQRRNRADNVHQHYTRHR 554 Q RIRHA RR +A Q R R Sbjct: 226 QGRIRHADRRYKATQFSQRAFRAR 249 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.315 0.132 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,663 Number of Sequences: 2352 Number of extensions: 10818 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -