BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O05 (614 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61480.1 68418.m07714 leucine-rich repeat transmembrane prote... 31 0.46 At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative... 31 0.46 At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 31 0.80 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 31 0.80 At4g28480.1 68417.m04074 DNAJ heat shock family protein contains... 30 1.1 At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP1... 30 1.4 At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to a... 30 1.4 At5g17760.1 68418.m02082 AAA-type ATPase family protein contains... 29 1.9 At1g62950.1 68414.m07108 leucine-rich repeat transmembrane prote... 29 3.2 At4g14160.2 68417.m02186 transport protein, putative similar to ... 28 5.7 At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-... 28 5.7 At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains... 27 7.5 At1g71240.1 68414.m08222 expressed protein contains Pfam profile... 27 7.5 At5g58100.1 68418.m07270 expressed protein 27 9.9 At4g19050.1 68417.m02806 mob1/phocein family protein contains Pf... 27 9.9 At4g13250.1 68417.m02060 short-chain dehydrogenase/reductase (SD... 27 9.9 At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding ... 27 9.9 At3g17490.1 68416.m02234 F-box family protein similar to F-box p... 27 9.9 >At5g61480.1 68418.m07714 leucine-rich repeat transmembrane protein kinase, putative Length = 1041 Score = 31.5 bits (68), Expect = 0.46 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 316 NNAFNYIQVSLQGKTSPMSKNDEASSNLLN--VPENVWSGPTIRPFVALFDN 465 NN F Q+ T+P+ + S+N + +PEN+W P ++ F A F N Sbjct: 450 NNRFTD-QIPADFATAPVLQYLNLSTNFFHRKLPENIWKAPNLQIFSASFSN 500 >At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 345 Score = 31.5 bits (68), Expect = 0.46 Identities = 33/154 (21%), Positives = 67/154 (43%), Gaps = 1/154 (0%) Frame = +1 Query: 85 AAGQIFNSILPNLISNSVTGQQGNTAQNTLQQIGTVVGGVVDYAKKKSYDDMLRQVQDST 264 A GQ+ ++ V G G+T + L + +Y ++ L++ + Sbjct: 167 AVGQLVGQFA-KMMGCYVVGSAGSTEKVDLLKTKFGFDDAFNYKEEPDLSAALKRCFPTG 225 Query: 265 TDDDLLRISEEMFNADINNAFNYIQVSLQGKTSPMS-KNDEASSNLLNVPENVWSGPTIR 441 D + +M +A + N + ++++ G S + +N E NL N+ ++ I+ Sbjct: 226 IDIYFENVGGKMLDAVLLNMNPHGRIAVCGMISQYNLENQEGVHNLSNI---IYKRIRIQ 282 Query: 442 PFVALFDNYHKNVIRPEFVTPNEETEQTTYINTI 543 F A+FD Y K +FV P+ + + TY+ + Sbjct: 283 GF-AVFDFYEKYSKFLDFVLPHIKEGKITYVEDV 315 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 30.7 bits (66), Expect = 0.80 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 256 DSTTDDDLLRISEEMFNADINNAFNYIQ 339 D +T D L +S EMF D NN +Y+Q Sbjct: 633 DLSTVRDALEVSAEMFKKDANNVSDYVQ 660 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 30.7 bits (66), Expect = 0.80 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 256 DSTTDDDLLRISEEMFNADINNAFNYIQ 339 D +T D L +S EMF D NN +Y+Q Sbjct: 633 DLSTVRDALEVSAEMFKKDANNVSDYVQ 660 >At4g28480.1 68417.m04074 DNAJ heat shock family protein contains Pfam profile PF00226: DnaJ domain; ; similar to DnaJ homolog subfamily B member 1 (Heat shock 40 kDa protein 1) (Heat shock protein 40) (HSP40) (DnaJ protein homolog 1) (HDJ-1) (Swiss-Prot:P25685) [Homo sapiens] and (Swiss-Prot:Q9QYJ3) [Mus musculus] Length = 348 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/89 (22%), Positives = 40/89 (44%), Gaps = 1/89 (1%) Frame = +1 Query: 277 LLRISEEMFNADINNAFNYIQVSLQGKTSPMSKND-EASSNLLNVPENVWSGPTIRPFVA 453 +L++ + D+ A+ + + +P +K D EA ++ +V S P R A Sbjct: 8 VLQVDRSANDDDLKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKR---A 64 Query: 454 LFDNYHKNVIRPEFVTPNEETEQTTYINT 540 ++D Y + ++ PN T +Y +T Sbjct: 65 VYDQYGEEGLKGNVPPPNAATSGASYFST 93 >At5g15450.1 68418.m01808 heat shock protein 100, putative / HSP100, putative / heat shock protein clpB, putative / HSP100/ClpB, putative similar to HSP100/ClpB GI:9651530 [Phaseolus lunatus] Length = 968 Score = 29.9 bits (64), Expect = 1.4 Identities = 20/84 (23%), Positives = 34/84 (40%) Frame = +1 Query: 70 DDIAQAAGQIFNSILPNLISNSVTGQQGNTAQNTLQQIGTVVGGVVDYAKKKSYDDMLRQ 249 D+I +A G +FN L L VT QG T T + + V + DD + Sbjct: 757 DEIEKAHGDVFNVFLQILDDGRVTDSQGRTVSFT-NTVIIMTSNVGSQFILNNTDDDANE 815 Query: 250 VQDSTTDDDLLRISEEMFNADINN 321 + T + ++ + +F + N Sbjct: 816 LSYETIKERVMNAARSIFRPEFMN 839 >At1g04580.1 68414.m00451 aldehyde oxidase, putative similar to aldehyde oxidases from Arabidopsis thaliana: GI:3172023, GI:3172025, GI:3172044; identical to cDNA putative aldehyde oxidase (AO2) mRNA, partial cds GI:2792305 Length = 1337 Score = 29.9 bits (64), Expect = 1.4 Identities = 24/92 (26%), Positives = 40/92 (43%) Frame = +1 Query: 37 ILLVSLGLCHADDIAQAAGQIFNSILPNLISNSVTGQQGNTAQNTLQQIGTVVGGVVDYA 216 I + GL AD++ +AGQI ++ + ++ + + IGT V V D Sbjct: 644 ITMFGTGLLFADEVTISAGQIIALVVADTQKHADMAAHLAVVEYDSRNIGTPVLSVEDAV 703 Query: 217 KKKSYDDMLRQVQDSTTDDDLLRISEEMFNAD 312 K+ S ++ + Q D IS+ M AD Sbjct: 704 KRSSLFEVPPEYQPEPVGD----ISKGMAEAD 731 >At5g17760.1 68418.m02082 AAA-type ATPase family protein contains Pfam profile: ATPase family PF00004 Length = 505 Score = 29.5 bits (63), Expect = 1.9 Identities = 31/112 (27%), Positives = 49/112 (43%), Gaps = 6/112 (5%) Frame = +1 Query: 187 TVVGGVVDYAKKKSYDDMLRQV-QDSTTDDDLL--RISEEMFNADINNAF---NYIQVSL 348 ++V + +Y K YD L V +DS LL R + DI+ A N I+ + Sbjct: 268 SLVAAMANYLKFDVYDLQLASVMRDSDLRRLLLATRNRSILVIEDIDCAVDLPNRIEQPV 327 Query: 349 QGKTSPMSKNDEASSNLLNVPENVWSGPTIRPFVALFDNYHKNVIRPEFVTP 504 +GK S+ S LLN + +WS + +F HK+ + P + P Sbjct: 328 EGKNRGESQGPLTLSGLLNFIDGLWSSCGDERII-IFTTNHKDRLDPALLRP 378 >At1g62950.1 68414.m07108 leucine-rich repeat transmembrane protein kinase, putative contains protein kinase domains Length = 890 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = +1 Query: 235 DMLRQVQDSTTDDDLLRISEEMFNADINNAFNYIQVSLQG 354 ++L Q +D+ DD ++ + NAD+ N+FN + + +G Sbjct: 34 EILLQFKDNINDDPYNSLASWVSNADLCNSFNGVSCNQEG 73 >At4g14160.2 68417.m02186 transport protein, putative similar to Swiss-Prot:Q15436 protein transport protein Sec23A [Homo sapiens] Length = 772 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +1 Query: 433 TIRPFVALFDNYHKNVIRPEFVTP-NEETEQTTYINTIL 546 T++P++ LF + N+ R +FV N ++T Y +L Sbjct: 579 TLKPYLTLFPQFMFNLRRSQFVQVFNNSPDETAYFRMLL 617 >At1g69780.1 68414.m08029 homeobox-leucine zipper protein 13 (HB-13) / HD-ZIP transcription factor 13 identical to homeobox gene 13 protein (GP:12325190) [Arabidopsis thaliana] Length = 294 Score = 27.9 bits (59), Expect = 5.7 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +1 Query: 220 KKSYDDMLRQVQDSTTDDDLLRISEEMFNADINNAFNYIQ---VSLQGKT--SPMSKNDE 384 +K YD + RQ ++DLL+ + A+I N Q ++L +T S +++D Sbjct: 143 EKDYDTLKRQFDTLKAENDLLQTHNQKLQAEIMGLKNREQTESINLNKETEGSCSNRSDN 202 Query: 385 ASSNL 399 +S NL Sbjct: 203 SSDNL 207 >At5g60450.1 68418.m07582 auxin-responsive factor (ARF4) contains Pfam profile: PF02362 B3 DNA binding domain; identical to cDNA auxin response factor 4 (ARF4) GI:4102597 Length = 788 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +1 Query: 184 GTVVGGVVDYAKKKSYDDMLRQVQDSTTDDDLLRISEE 297 G+ VG +D ++ YDD+L +++ + LLR E+ Sbjct: 674 GSQVGRAIDLSRLNGYDDLLMELERLFNMEGLLRDPEK 711 >At1g71240.1 68414.m08222 expressed protein contains Pfam profile: PF04842 plant protein of unknown function (DUF639) Length = 824 Score = 27.5 bits (58), Expect = 7.5 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +2 Query: 182 SVRLSVASLIMLKRKATMTCYVKYRILRRT 271 S L+VA L +++R AT TC KY+++ +T Sbjct: 562 SKHLAVADLTLVER-ATETCRQKYKVVEKT 590 >At5g58100.1 68418.m07270 expressed protein Length = 945 Score = 27.1 bits (57), Expect = 9.9 Identities = 10/39 (25%), Positives = 22/39 (56%) Frame = +1 Query: 142 GQQGNTAQNTLQQIGTVVGGVVDYAKKKSYDDMLRQVQD 258 G +G + +L +GT +G V + ++ ++ D + +QD Sbjct: 409 GGEGVRTELSLPNVGTTIGAVAEISEDEAEDKLQTAIQD 447 >At4g19050.1 68417.m02806 mob1/phocein family protein contains Pfam PF03637: Mob1/phocein family; contains Pfam F00560: Leucine Rich Repeats; contains TIGRFAMS profile TIGR01612: reticulocyte binding protein; hypothetical protein YIL106w, Saccharomyces cerevisiae, PIR2:S48466 Length = 1405 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 460 DNYHKNVIRPEFVTPNEETEQTTYINTIL 546 D HKN I PE TP + T+ T I I+ Sbjct: 1160 DQPHKNTIGPETQTPTQPTKATDTIFRIV 1188 >At4g13250.1 68417.m02060 short-chain dehydrogenase/reductase (SDR) family protein contains INTERPRO family IPR002198 Short-chain dehydrogenase/reductase (SDR) superfamily Length = 496 Score = 27.1 bits (57), Expect = 9.9 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +1 Query: 460 DNYHKNVIRPEFVTPNEETEQTTYINTILATGPIRTLMNFLVSKGLTQMN 609 D Y++ V E V + + YI T+ +TG I L+ F +S G + MN Sbjct: 82 DEYNQKVENLEMVFSSVAVQIARYIVTMTSTGAI-LLIGFQLSGGDSSMN 130 >At3g48870.1 68416.m05338 ATP-dependent Clp protease ATP-binding subunit (ClpC) identical to AtClpC GI:5360574 from [Arabidopsis thaliana]; contains Pfam profiles PF02861: Clp amino terminal domain and PF02151: UvrB/uvrC motif Length = 952 Score = 27.1 bits (57), Expect = 9.9 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 3/80 (3%) Frame = +1 Query: 70 DDIAQAAGQIFNSILPNLISNSVTGQQGNTA--QNTLQQIGTVVG-GVVDYAKKKSYDDM 240 D+I +A +FN +L L +T +G T +NTL + + VG V++ ++ D+ Sbjct: 738 DEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTLLIMTSNVGSSVIEKGGRRIGFDL 797 Query: 241 LRQVQDSTTDDDLLRISEEM 300 +DS+ + ++EE+ Sbjct: 798 DHDEKDSSYNRIKSLVTEEL 817 >At3g17490.1 68416.m02234 F-box family protein similar to F-box protein family, AtFBX9 (GI:20197985) [Arabidopsis thaliana]; contains Pfam PF00646: F-box domain and TIGRFAM TIGR01640: F-box protein interaction domain Length = 388 Score = 27.1 bits (57), Expect = 9.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = -3 Query: 183 DLLQCILSRIPLLSSHRIRY 124 DL++ ILSR+P +S R+RY Sbjct: 9 DLVEEILSRVPAISLKRLRY 28 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.132 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,285,338 Number of Sequences: 28952 Number of extensions: 233054 Number of successful extensions: 745 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1236350304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -