BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_O03 (647 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48133| Best HMM Match : RYDR_ITPR (HMM E-Value=2) 35 0.050 SB_31468| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_45475| Best HMM Match : RhoGAP (HMM E-Value=1.26117e-44) 27 9.9 >SB_48133| Best HMM Match : RYDR_ITPR (HMM E-Value=2) Length = 671 Score = 35.1 bits (77), Expect = 0.050 Identities = 24/99 (24%), Positives = 39/99 (39%) Frame = +2 Query: 218 RMFLNEDPVLIINKRDELALKLQLSMDNDGDRASFGDGADKTSHRVSWRIYPLWEKNRVY 397 R+F D ++ D++AL L + N R+ D S +P W N + Sbjct: 178 RLFWEGDQKARESESDDMALDLFVRQGNTTWRSGKSDNCQNNRPTSSRSYFPKWRSNNEF 237 Query: 398 IKILNIHRNQYLKLEIKSDVDGDHKAFGADADDTYRHQW 514 LN + N+Y K + + D + +D T H W Sbjct: 238 QDFLNSNANRYDKFLVVNRFHSDMCRYHSDL--TRHHFW 274 >SB_31468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 7.5 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 338 KTSHRVSWRIYPLWEKNRVYIKILNIHRNQYLKLEI 445 K SH +R +WE ++ Y+K +NI ++ KLE+ Sbjct: 57 KLSHSTMFRKLFVWETSKTYLKDINI---RHFKLEV 89 >SB_45475| Best HMM Match : RhoGAP (HMM E-Value=1.26117e-44) Length = 552 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/64 (23%), Positives = 29/64 (45%) Frame = +2 Query: 5 YEQLYDSVVVGDYKAAVMKTLRLENDGXGEVINLVVNRLLSEGKRNIVEYAYKLWNMFGT 184 + QL + ++ Y + +KT+R+E+D L + LL ++Y K F + Sbjct: 252 FRQLQEPLLTNTYHDSFIKTMRIEDDNTRTKAMLYICLLLPLAHLQALKYTMKFLAEFAS 311 Query: 185 NIVK 196 + K Sbjct: 312 HSEK 315 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,954,211 Number of Sequences: 59808 Number of extensions: 376577 Number of successful extensions: 1255 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1252 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -