BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_N14 (276 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0971 + 8169197-8169311,8170351-8170458,8170533-8170725,817... 65 7e-12 01_06_1654 - 38924090-38924101,38924183-38924215,38924737-389248... 60 2e-10 03_06_0563 - 34738732-34738890,34738965-34739009,34739154-347392... 59 6e-10 05_06_0014 + 24854462-24854570,24854958-24855065,24855240-248554... 57 2e-09 06_03_1219 - 28491185-28494415 29 0.53 08_02_1620 - 28288152-28288353,28288469-28288557,28288634-282888... 27 1.6 12_01_0423 + 3337401-3337419,3337777-3338235,3338650-3338735,333... 27 2.1 11_04_0443 - 17808897-17809110,17809169-17813652 27 2.8 09_01_0088 + 1268120-1268139,1268288-1268361,1268500-1268750,126... 27 2.8 02_05_0792 - 31777775-31778220,31778506-31778630,31778724-317789... 27 2.8 04_03_0051 + 10199702-10199839,10199869-10200642,10202481-102030... 26 3.7 12_02_1131 - 26358339-26360609 26 5.0 11_06_0348 - 22561589-22563656,22563788-22564602 26 5.0 09_02_0257 + 6355876-6356444,6356690-6357136,6357231-6359166 26 5.0 12_01_0177 - 1312229-1312498,1314758-1315630,1315729-1315885,131... 25 6.5 11_04_0236 + 15215386-15216197,15216854-15218888,15219131-152200... 25 6.5 11_01_0176 - 1403284-1403553,1404313-1404468,1404569-1404787,140... 25 6.5 10_08_1002 + 22160109-22160264,22160374-22160484,22160612-221606... 25 6.5 10_02_0058 - 4695400-4695648,4695846-4696112,4706026-4706430 25 6.5 05_04_0248 - 19363567-19363814,19363900-19364092,19364202-19364846 25 6.5 02_02_0127 - 7038149-7038292,7038380-7038697,7038781-7038879,703... 25 6.5 11_07_0017 - 27451548-27451913,27452000-27452812 25 8.7 11_06_0389 + 23055896-23056486,23056957-23057109,23057652-230579... 25 8.7 09_02_0264 + 6422062-6422874,6422961-6423326 25 8.7 >07_01_0971 + 8169197-8169311,8170351-8170458,8170533-8170725, 8170811-8171069,8171151-8171207,8171433-8171480, 8171571-8171657,8171743-8171800,8171891-8171958, 8172066-8172161,8172244-8172291,8172658-8172696, 8172782-8172868,8173136-8173147 Length = 424 Score = 65.3 bits (152), Expect = 7e-12 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%) Frame = +2 Query: 92 EVFFEEKFSDDSWESNWVYSEHPGKE--FGKFKLTAGKFYNDAEADKGLQTSEDARFYAL 265 EVFF+EKF +D WES WV SE E G++ T+GK+ D E DKG+QTSED RFYA+ Sbjct: 30 EVFFQEKF-EDGWESRWVKSEWKKDENMAGEWNHTSGKWNGDPE-DKGIQTSEDYRFYAI 87 Query: 266 S 268 S Sbjct: 88 S 88 >01_06_1654 - 38924090-38924101,38924183-38924215,38924737-38924829, 38924909-38924965,38925048-38925143,38925237-38925304, 38925429-38925486,38925572-38925658,38925935-38925982, 38926060-38926116,38926200-38926458,38926666-38926858, 38926991-38927098,38927849-38927957 Length = 425 Score = 60.1 bits (139), Expect = 2e-10 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = +2 Query: 92 EVFFEEKFSDDSWESNWVYSEHPGKE--FGKFKLTAGKFYNDAEADKGLQTSEDARFYAL 265 EV FEE+F +D WES WV S+ E G FK TAG++ D + DKG+QT+ DAR +A+ Sbjct: 28 EVIFEERF-EDGWESRWVKSDWKRSEGKAGTFKHTAGRYSGDPD-DKGIQTTLDARHFAI 85 Query: 266 SRK 274 S K Sbjct: 86 SAK 88 >03_06_0563 - 34738732-34738890,34738965-34739009,34739154-34739201, 34739291-34739386,34739467-34739534,34739633-34739690, 34739783-34739869,34740004-34740051,34740360-34740416, 34740525-34740783,34740877-34741102,34741168-34741275, 34741885-34741987 Length = 453 Score = 58.8 bits (136), Expect = 6e-10 Identities = 39/99 (39%), Positives = 51/99 (51%), Gaps = 13/99 (13%) Frame = +2 Query: 17 LAVN*KMKSAVXXXXXXXXXXXXNCEVFFEEKFSDDSWESNWVYSE--HPGKEFGKFKLT 190 +A+ + +AV EVFF+EKF DD WE WV SE G++ T Sbjct: 1 MAIPRRSAAAVAAVVALASVAAVAGEVFFQEKF-DDGWEDRWVKSEWKKDDNRAGEWNHT 59 Query: 191 AGKFYNDAEADKGL-----------QTSEDARFYALSRK 274 +GK+Y DA+ DKG+ QTSED RFYA+S K Sbjct: 60 SGKWYGDAD-DKGMCEVTLLLCAGIQTSEDYRFYAISAK 97 >05_06_0014 + 24854462-24854570,24854958-24855065,24855240-24855432, 24855892-24856150,24856236-24856292,24856370-24856417, 24856725-24856811,24856885-24856942,24857084-24857151, 24857279-24857374,24857483-24857539,24857906-24857952, 24858184-24858210,24858312-24858504 Length = 468 Score = 56.8 bits (131), Expect = 2e-09 Identities = 30/63 (47%), Positives = 40/63 (63%), Gaps = 2/63 (3%) Frame = +2 Query: 92 EVFFEEKFSDDSWESNWVYSEHPGKE--FGKFKLTAGKFYNDAEADKGLQTSEDARFYAL 265 EV FEE+F DD W S WV S+ E G FK TAG + D + D+G+QT+ DA+ +A+ Sbjct: 28 EVIFEERFDDD-WGSRWVKSDWKKSEGKAGTFKHTAGSYSGDPD-DRGIQTTSDAKHFAI 85 Query: 266 SRK 274 S K Sbjct: 86 SAK 88 >06_03_1219 - 28491185-28494415 Length = 1076 Score = 29.1 bits (62), Expect = 0.53 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 159 GCSLYTQFDSHESSENFSSKNTSQFIDEIANKLAIAST 46 G SL+ S ++N SSK+T F+ E+A + A A T Sbjct: 741 GASLFDSMSSELYNDNDSSKDTIFFMSEVAGEAAKAVT 778 >08_02_1620 - 28288152-28288353,28288469-28288557,28288634-28288828, 28289082-28289423,28290227-28291672,28292590-28292666, 28293160-28294509,28295921-28296029,28296896-28297007, 28297800-28297957 Length = 1359 Score = 27.5 bits (58), Expect = 1.6 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = -1 Query: 252 LASSDVCKPLSASASL*NFPAVNLNLPNSFPGCS--LYTQF-DSHESSENFSSKNTSQF 85 +A S K + ASA + + + +P S+P CS L +F D +S++ S+K S+F Sbjct: 1248 VAVSPSLKSMFASAQMSPILPLRVLVPASYPKCSPVLLDKFPDEQRNSDDLSTKARSKF 1306 >12_01_0423 + 3337401-3337419,3337777-3338235,3338650-3338735, 3338974-3339022,3339225-3339533,3339555-3339710, 3339871-3340086,3340404-3340906,3341050-3341116, 3341215-3341272,3341561-3341699,3341840-3341956, 3342069-3342246,3342459-3343093 Length = 996 Score = 27.1 bits (57), Expect = 2.1 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -1 Query: 180 NLPNSFPGCSLYTQFDSHESSENFSSKNTSQFIDEIANKLAIASTADF 37 N PN+FP S F + S F S S + I++ A AS++ F Sbjct: 457 NPPNAFPSASANNPFAPKQPSTGFGS--ISSVFNSISSNTAPASSSPF 502 >11_04_0443 - 17808897-17809110,17809169-17813652 Length = 1565 Score = 26.6 bits (56), Expect = 2.8 Identities = 16/49 (32%), Positives = 22/49 (44%), Gaps = 3/49 (6%) Frame = -1 Query: 201 NFPAVNLNLPNSFPGCSLYTQFDSHESSENFSSKNTS---QFIDEIANK 64 NF VNL +PN YT E +N+ + S F+D+I K Sbjct: 1086 NFVIVNLKIPNDQSAVPAYTVLSLLECIQNWIACQVSLPKDFLDKICKK 1134 >09_01_0088 + 1268120-1268139,1268288-1268361,1268500-1268750, 1268845-1269048,1269488-1269805,1269893-1269910 Length = 294 Score = 26.6 bits (56), Expect = 2.8 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 104 EEKFSDDSWESNWVYSEHPGK-EFGKFKLTAGKFYNDAEADKGLQT 238 E KF+ D +NW+ + GK K KL G + + ++ LQT Sbjct: 115 ERKFAIDGRANNWILHQLDGKLRQYKSKLKKGYYKPNLPMERALQT 160 >02_05_0792 - 31777775-31778220,31778506-31778630,31778724-31778911, 31779716-31779892 Length = 311 Score = 26.6 bits (56), Expect = 2.8 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Frame = -2 Query: 242 QMSVNLYPPLRHCRTFQQSI*TCRILFRGVHYIPNLIPMN---RLRIFPQRTLHNL 84 ++ +L+P +RH + SI I G+H P L +N R+R RT+ +L Sbjct: 100 EILASLFPSIRHFAFEESSIRPSIISRYGIHGFPTLFLLNSTMRVRYHGPRTVKSL 155 >04_03_0051 + 10199702-10199839,10199869-10200642,10202481-10203077, 10237046-10237159 Length = 540 Score = 26.2 bits (55), Expect = 3.7 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 182 KLTAGKFYNDAEADKGLQTSEDARFYALSRK 274 ++ AGK Y E D +T E ARF + R+ Sbjct: 187 RMVAGKQYYGGEGDAEAETEEAARFREMVRE 217 >12_02_1131 - 26358339-26360609 Length = 756 Score = 25.8 bits (54), Expect = 5.0 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 143 PNLIPMNRLRIFPQRTLHNLLTK 75 P+L+ MN+L ++ Q LH + TK Sbjct: 206 PDLVHMNKLAVYAQGHLHWITTK 228 >11_06_0348 - 22561589-22563656,22563788-22564602 Length = 960 Score = 25.8 bits (54), Expect = 5.0 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 158 PGKEFGKFKLTAGKFYNDAEADKGLQ 235 P K +FK+TAGKF N + +GL+ Sbjct: 737 PPKFLDEFKVTAGKFANVPQWIEGLE 762 >09_02_0257 + 6355876-6356444,6356690-6357136,6357231-6359166 Length = 983 Score = 25.8 bits (54), Expect = 5.0 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 122 DSWESNWVYSEHPGKEFGKFK 184 D W+S+W Y+ P K F+ Sbjct: 157 DDWKSDWFYTPSPTKRASDFR 177 >12_01_0177 - 1312229-1312498,1314758-1315630,1315729-1315885, 1316207-1316247 Length = 446 Score = 25.4 bits (53), Expect = 6.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 134 IPMNRLRIFPQRTLHNLLTKLP 69 I + +R+F ++TL N+LT +P Sbjct: 318 IKASTIRLFDEKTLQNILTGIP 339 >11_04_0236 + 15215386-15216197,15216854-15218888,15219131-15220017, 15222420-15226194 Length = 2502 Score = 25.4 bits (53), Expect = 6.5 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 149 SEHPGKEFGKFKLTAGKFYNDAEADKGLQT 238 S HPG F+L G FY D + + T Sbjct: 1871 SNHPGNPRINFQLVDGVFYGDEDEEHATPT 1900 >11_01_0176 - 1403284-1403553,1404313-1404468,1404569-1404787, 1405198-1405440,1405539-1405695,1406186-1406226 Length = 361 Score = 25.4 bits (53), Expect = 6.5 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = -2 Query: 134 IPMNRLRIFPQRTLHNLLTKLP 69 I + +R+F ++TL N+LT +P Sbjct: 181 IKASTIRLFDEKTLQNILTGIP 202 >10_08_1002 + 22160109-22160264,22160374-22160484,22160612-22160689, 22160774-22160921,22161007-22161077,22161430-22161526, 22161603-22161790,22161960-22162223 Length = 370 Score = 25.4 bits (53), Expect = 6.5 Identities = 11/50 (22%), Positives = 21/50 (42%) Frame = -1 Query: 186 NLNLPNSFPGCSLYTQFDSHESSENFSSKNTSQFIDEIANKLAIASTADF 37 N+N P S SH + ++S +T F+ + ++ S + F Sbjct: 252 NMNQAGDMPSFSHAMSSSSHHNKRQYASDHTQDFVVKAVRQVLFDSISSF 301 >10_02_0058 - 4695400-4695648,4695846-4696112,4706026-4706430 Length = 306 Score = 25.4 bits (53), Expect = 6.5 Identities = 7/19 (36%), Positives = 14/19 (73%) Frame = -2 Query: 116 RIFPQRTLHNLLTKLPINW 60 R+FP+RT+H + + ++W Sbjct: 114 RLFPERTMHLVCSSFSLHW 132 >05_04_0248 - 19363567-19363814,19363900-19364092,19364202-19364846 Length = 361 Score = 25.4 bits (53), Expect = 6.5 Identities = 14/52 (26%), Positives = 26/52 (50%) Frame = -1 Query: 198 FPAVNLNLPNSFPGCSLYTQFDSHESSENFSSKNTSQFIDEIANKLAIASTA 43 +PA + PN P ++ T+F H+++E +++Q + A A TA Sbjct: 10 YPAPESHPPNHNPTHAIATKFPIHKTAETLVITSSAQLSSLLLPGEAAAGTA 61 >02_02_0127 - 7038149-7038292,7038380-7038697,7038781-7038879, 7038958-7039050,7039138-7039341,7039435-7039525, 7039593-7039695,7039761-7039907,7040825-7040876, 7041003-7041138,7041846-7041911,7041981-7042045 Length = 505 Score = 25.4 bits (53), Expect = 6.5 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +2 Query: 104 EEKFSDDSWESNWVYSEHPGK-EFGKFKLTAGKFYNDAEADKGLQT 238 E KF+ D +NW+ + GK K KL G + + ++ LQT Sbjct: 220 ERKFAIDGRANNWILHQLDGKWRQYKSKLKKGYYKPNLPMERVLQT 265 >11_07_0017 - 27451548-27451913,27452000-27452812 Length = 392 Score = 25.0 bits (52), Expect = 8.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 110 KFSDDSWESNWVYSEHP 160 K S++ W +NW Y ++P Sbjct: 131 KTSNNGWHANWFYVQNP 147 >11_06_0389 + 23055896-23056486,23056957-23057109,23057652-23057957, 23058558-23058995 Length = 495 Score = 25.0 bits (52), Expect = 8.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 37 EICSAGYCQFIGNFVNKL 90 EI S GY F+ N VNKL Sbjct: 329 EISSKGYGSFVSNRVNKL 346 >09_02_0264 + 6422062-6422874,6422961-6423326 Length = 392 Score = 25.0 bits (52), Expect = 8.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 110 KFSDDSWESNWVYSEHP 160 K S++ W +NW Y ++P Sbjct: 131 KTSNNGWHANWFYVQNP 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,102,272 Number of Sequences: 37544 Number of extensions: 124801 Number of successful extensions: 431 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 14,793,348 effective HSP length: 69 effective length of database: 12,202,812 effective search space used: 268461864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -