BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_N07 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 25 0.53 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 2.1 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 3.7 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 22 4.9 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.5 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 25.0 bits (52), Expect = 0.53 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 85 DPCMKVHCSAGRVCEIN 135 DPC +C G+ CE++ Sbjct: 80 DPCASKYCGIGKECELS 96 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 2.1 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 430 LGQFAHNVTTHSRMRRGKSDISFS 359 LG A +++ R RRG +D+S + Sbjct: 11 LGSIARSLSLDRRARRGAADLSLA 34 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 270 SSSISAVTPPLLYAQVSLKFVHTLRLESVSYGHS 169 S ++ +TP LL S VH+ E+ S GHS Sbjct: 365 SDNMMMITPELLGLMPSGSSVHSDSGENNSRGHS 398 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 98 KCTAAPAVSVRSTSTGKVSGDGIKECPY 181 KC+ P++ +TS GD +C Y Sbjct: 21 KCSGYPSIRQGTTSYCLGCGDSCHKCKY 48 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 109 CSALSCTDRPD*FHCQE 59 C+A+ +P FHC E Sbjct: 1715 CTAVETKSKPYKFHCME 1731 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,154 Number of Sequences: 438 Number of extensions: 3735 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -