BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_N07 (569 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56900.2 68418.m07101 CwfJ-like family protein / zinc finger ... 30 0.95 At5g56900.1 68418.m07100 CwfJ-like family protein / zinc finger ... 30 0.95 At4g32760.1 68417.m04661 VHS domain-containing protein / GAT dom... 30 0.95 At3g44610.1 68416.m04796 protein kinase family protein similar t... 29 2.2 At3g62630.1 68416.m07035 expressed protein 29 2.9 At1g49890.1 68414.m05593 expressed protein contains Pfam domain,... 28 3.8 At3g18830.1 68416.m02391 mannitol transporter, putative similar ... 28 5.0 At3g02550.1 68416.m00244 LOB domain protein 41 / lateral organ b... 28 5.0 At5g41120.1 68418.m04999 esterase/lipase/thioesterase family pro... 27 6.7 At3g09000.1 68416.m01053 proline-rich family protein 27 6.7 At2g21090.1 68415.m02503 pentatricopeptide (PPR) repeat-containi... 27 8.8 >At5g56900.2 68418.m07101 CwfJ-like family protein / zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar), PF04677: Protein similar to CwfJ C-terminus 1, PF04676: Protein similar to CwfJ C-terminus 2 Length = 593 Score = 30.3 bits (65), Expect = 0.95 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = -3 Query: 525 HHFQMAALVQRRVRLDSASRSMRSYWGLSSPRSASSPIM 409 H FQ + +QR+ R ++A+RS ++ LSSP S I+ Sbjct: 357 HEFQDESSIQRKPRSENANRSKECWFCLSSPSVESHLIV 395 >At5g56900.1 68418.m07100 CwfJ-like family protein / zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar), PF04677: Protein similar to CwfJ C-terminus 1, PF04676: Protein similar to CwfJ C-terminus 2 Length = 404 Score = 30.3 bits (65), Expect = 0.95 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = -3 Query: 525 HHFQMAALVQRRVRLDSASRSMRSYWGLSSPRSASSPIM 409 H FQ + +QR+ R ++A+RS ++ LSSP S I+ Sbjct: 168 HEFQDESSIQRKPRSENANRSKECWFCLSSPSVESHLIV 206 >At4g32760.1 68417.m04661 VHS domain-containing protein / GAT domain-containing protein weak similarity to hepatocyte growth factor-regulated tyrosine kinase substrate HRS isoform 2 [Homo sapiens] GI:9022389; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 838 Score = 30.3 bits (65), Expect = 0.95 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 319 ICTWWYCAPRHSSECSLQLYFCCYSSPSL 233 IC P + S CSL+ FCCY S SL Sbjct: 25 ICDMLNSDPAYVSLCSLRFCFCCYLSLSL 53 >At3g44610.1 68416.m04796 protein kinase family protein similar to viroid symptom modulation protein (protein kinase)[Lycopersicon esculentum] gi|7672777|gb|AAF66637; contains protein kinase domain, Pfam:PF00069 Length = 451 Score = 29.1 bits (62), Expect = 2.2 Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Frame = -3 Query: 378 SLTFRSRCTPAFPCKSRSTRSARGGTAPRGTAPSVHSSSISAVTPPLLYAQVSLKFVH-T 202 S++F S T S +RS+ A APS H S S+ PP L + +SL + Sbjct: 14 SVSFTSAGTTVNRSTSSGSRSSSSAAALT-PAPSAHGSFSSSKLPPSLRSSLSLSDLRFR 72 Query: 201 LRLESVSYGHSLIPSPDTFPVLVDLTDT 118 LRL S G + F L +T+T Sbjct: 73 LRLGSGDIGSVFLAE---FKSLTAVTET 97 >At3g62630.1 68416.m07035 expressed protein Length = 380 Score = 28.7 bits (61), Expect = 2.9 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 2/90 (2%) Frame = +3 Query: 141 RGRYLETESRSVHTKPTLGARCAQTSTRPGHREGEE*QQK*SWSEHSELCRGAQYHHVQI 320 RGR L+ SRSVH K + + + EGEE ++ E E R Q + Sbjct: 152 RGRDLKLRSRSVHRKARSLSPLRNAAYQWNQEEGEE-EEVAGEREVKECIRKLQ----ED 206 Query: 321 EYYGTCREMPEC--SENEMSDFPRRMREWV 404 E + P C S + S + R ++W+ Sbjct: 207 ENVPSAETTPSCSASSSRSSSYGRNSKKWI 236 >At1g49890.1 68414.m05593 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 659 Score = 28.3 bits (60), Expect = 3.8 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 4/65 (6%) Frame = -3 Query: 444 LSSPRSASSPIM*PPIRACAAGSLTFRSRCTPA----FPCKSRSTRSARGGTAPRGTAPS 277 LSSPR +SP+ IR+ + L + +PA P ++R+ S + R PS Sbjct: 376 LSSPRGMASPVRGSAIRSASPSKLWATTTSSPARALSSPSRARNGVSDQMNAYNRNNTPS 435 Query: 276 VHSSS 262 + S S Sbjct: 436 ILSFS 440 >At3g18830.1 68416.m02391 mannitol transporter, putative similar to mannitol transporter [Apium graveolens var. dulce] GI:12004316; contains Pfam profile PF00083: major facilitator superfamily protein Length = 539 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 4/49 (8%) Frame = +1 Query: 103 HCSAGRVCEINEHGEGIWR----RNQGVSIRNRL*AQGVHKLQRDLGIE 237 H +V N HGEG+WR R R + A G+H Q+ GI+ Sbjct: 263 HDDVVQVSRRNSHGEGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGID 311 >At3g02550.1 68416.m00244 LOB domain protein 41 / lateral organ boundaries domain protein 41 (LBD41) identical to LOB DOMAIN 41 [Arabidopsis thaliana] GI:17227172 Length = 263 Score = 27.9 bits (59), Expect = 5.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 267 SSISAVTPPLLYAQVSLKFVHTLRLESVSYGHSLIP 160 S + A +PP + +K TLRLE VS + ++P Sbjct: 204 SEVLAFSPPAVKGSGEIKLDLTLRLEPVSRAYHVVP 239 >At5g41120.1 68418.m04999 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 684 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = +3 Query: 231 HREGEE*QQK*SWSEHSELCRGAQYHHVQIEYYGTCREMPEC 356 HR+GEE K W EHSE R A +I +G E C Sbjct: 513 HRKGEE--YKLFWPEHSEFVRIASKFGAKIIPFGVVGEDDLC 552 >At3g09000.1 68416.m01053 proline-rich family protein Length = 541 Score = 27.5 bits (58), Expect = 6.7 Identities = 21/66 (31%), Positives = 27/66 (40%) Frame = +1 Query: 247 SNSRNRAGVNTRSCAAGXXXXXXXXXXXGLAGKCRSAARTKCQTSRGACANGWSHYGRTG 426 S SR R GV + A G +G +A R C SRG G ++ TG Sbjct: 321 SASRGRPGV---ASAPGSRSGSIERGGGPTSGGSGNARRQSCSPSRGRAPIGNTNGSLTG 377 Query: 427 RAGRAQ 444 GRA+ Sbjct: 378 VRGRAK 383 >At2g21090.1 68415.m02503 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 597 Score = 27.1 bits (57), Expect = 8.8 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = -3 Query: 192 ESVSYGHSLIPSPDTFPVLVDLTDTAGAAVHFHARIVQIDF 70 ES++ H ++P + + L+DL AG +I ++ F Sbjct: 437 ESMTVQHGIVPDQEHYACLIDLLGRAGCFKELMRKIEEMPF 477 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,747,317 Number of Sequences: 28952 Number of extensions: 275124 Number of successful extensions: 977 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 943 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -