BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_N04 (572 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprote... 25 1.3 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 5.3 >AF510715-1|AAP47144.1| 470|Anopheles gambiae Rh-like glycoprotein protein. Length = 470 Score = 25.4 bits (53), Expect = 1.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -3 Query: 174 SCGRTKLSGKGAMMASIFINCVKAHAGVQTFG 79 +CG L G A++++IF + A V+T+G Sbjct: 335 TCGVHNLHGMPAVLSAIFSAIYASFASVETYG 366 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 5.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 167 PQLHSPITSVTDPSGLKLAPVSLHHINNECESL 265 PQ+ SPI + D L+L P + ++ E L Sbjct: 14 PQISSPILNPEDTQKLQLLPAVRRPLLSDAEKL 46 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 622,665 Number of Sequences: 2352 Number of extensions: 13172 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54245403 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -