BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_N01 (507 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10) 30 1.3 SB_39668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_27587| Best HMM Match : Peptidase_M14 (HMM E-Value=0) 27 6.7 SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) 27 6.7 SB_23383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_45775| Best HMM Match : Extensin_2 (HMM E-Value=2.3) 27 8.9 SB_30408| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 >SB_51861| Best HMM Match : RVT_1 (HMM E-Value=1.2e-10) Length = 1318 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 222 PSIIDDIKLDPNRRYTRSIHSHREKRSLSRNY 317 PS + D P RR TR + S REK SR Y Sbjct: 333 PSNLQDDDTSPPRRSTRELDSIREKERKSRQY 364 >SB_39668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.1 bits (62), Expect = 2.2 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 26 NRITDCVNDALGREFLSALHTTNIQTSSDEAHQYSKITGSWR 151 N T+ D E + HTTN +SSDE + G W+ Sbjct: 13 NVSTETFEDYSDSESSQSDHTTNEDSSSDETESMDRFHGHWK 54 >SB_27587| Best HMM Match : Peptidase_M14 (HMM E-Value=0) Length = 879 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +3 Query: 183 ISPAPTSGDHPILPSIIDDIK---LDPNRRYTRSIHSHREKRSLSRNYYTSFPIHLPPFY 353 ISP PT + +P DD+K D + H+H+E S + + +P H+ Y Sbjct: 464 ISPMPTQVPYSFIPMSADDVKEIVKDWVKPRIFKHHTHKEMTSFLKKVHELYP-HITRLY 522 >SB_22355| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1252 Score = 27.5 bits (58), Expect = 6.7 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +3 Query: 276 IHSHREKRSLSRNYYTSFPIHLPPFYPRPII 368 + E R + + +YTS+P H P +P P++ Sbjct: 837 MQEEEEPRQVRQYHYTSWPDHGVPAHPAPLL 867 >SB_23383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 27.5 bits (58), Expect = 6.7 Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +3 Query: 183 ISPAPTSGDHPILPSIIDDIK---LDPNRRYTRSIHSHREKRSLSRNYYTSFPIHLPPFY 353 ISP PT + +P DD+K D + H+H+E S + + +P H+ Y Sbjct: 464 ISPMPTQVPYSFIPMSADDVKEIVKDWVKPRIFKHHTHKEMTSFLKKVHELYP-HITRLY 522 >SB_45775| Best HMM Match : Extensin_2 (HMM E-Value=2.3) Length = 584 Score = 27.1 bits (57), Expect = 8.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 127 FEDYGKLEMNH*GCTRAMTFHLRQRVVTIQYCLQSLT 237 F+ K ++ GCTR + QR++ I CL +T Sbjct: 8 FDSGIKFQITEYGCTRESVYSNTQRLMGITKCLMGIT 44 >SB_30408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 593 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 50 DALGREFLSALHTTNIQTSSDEAHQY-SKITGSW 148 D + + L+ LH T + S + HQY SK SW Sbjct: 452 DQMSQAILAVLHHTVLSDDSKKRHQYCSKGNNSW 485 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,047,559 Number of Sequences: 59808 Number of extensions: 291547 Number of successful extensions: 608 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 573 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -