BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M23 (601 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF... 26 3.7 SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|... 25 8.5 >SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF|Schizosaccharomyces pombe|chr 3|||Manual Length = 892 Score = 26.2 bits (55), Expect = 3.7 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = -3 Query: 581 LLYENKTCQILIRLVICYKYINFLKKCTTIVSNKRITIIHYKDNS 447 L+ + T + L+ ++CY ++FLK T+V + + + Y N+ Sbjct: 278 LVGDLSTLKFLLSALVCYDCVSFLKLLDTLVLS--VNVSSYPSNA 320 >SPBC27B12.03c |||lathosterol oxidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 25.0 bits (52), Expect = 8.5 Identities = 9/29 (31%), Positives = 18/29 (62%) Frame = +2 Query: 197 LRGESYVFIIIDEVIFYVIYVDVSTFELF 283 +RG YV+ +DE ++ ++ ++ F LF Sbjct: 133 IRGYGYVYDKLDEYGYFYLFFSIALFLLF 161 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,284,602 Number of Sequences: 5004 Number of extensions: 40894 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 262236260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -