BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M23 (601 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13176| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) 27 8.8 SB_33443| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-08) 27 8.8 >SB_13176| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 505 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = +1 Query: 7 LRKHHSELGDKCSDLQREIRYIKGLMRDLFKAKGLIK*IHSVNRLQ 144 L+K ++ DLQ EI Y+KG++ + + GL+K I + + ++ Sbjct: 304 LQKDCEDMKGLVKDLQMEIAYLKGVLANESQLAGLLKNIGNTDGVE 349 >SB_11234| Best HMM Match : DSPc (HMM E-Value=2.4e-29) Length = 2072 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 1 QALRKHHSELGDKCSDLQREIRYIKGLMRDLFKAK 105 + LR + L D + QR IKGL+RDL K Sbjct: 1591 ETLRDYEGRLSDLTIEKQRNEERIKGLVRDLSTLK 1625 >SB_33443| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.1e-08) Length = 415 Score = 27.5 bits (58), Expect = 8.8 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +3 Query: 105 RSNQINPQRQPPPAIESVKTAYL 173 R++Q+NP++ PPP + K +L Sbjct: 335 RAHQLNPEKIPPPPLRVAKAEHL 357 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,690,598 Number of Sequences: 59808 Number of extensions: 305246 Number of successful extensions: 591 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 589 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -