BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M21 (545 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M69008-1|AAA52754.1| 623|Homo sapiens alpha-1 type XIII collage... 33 0.86 AL138925-3|CAI15452.1| 683|Homo sapiens collagen type XIII alph... 31 2.0 AL138925-2|CAI15451.2| 695|Homo sapiens collagen type XIII alph... 31 2.0 AL138925-1|CAI15450.1| 717|Homo sapiens collagen type XIII alph... 31 2.0 AJ293624-1|CAC00688.1| 717|Homo sapiens type XIII collagen prot... 31 2.0 U47004-2|AAB19039.1| 1690|Homo sapiens collagen type IV a6 chain... 31 3.5 U47004-1|AAB19038.1| 1691|Homo sapiens collagen type IV a6 chain... 31 3.5 U04845-1|AAA19569.2| 1691|Homo sapiens A type IV collagen protein. 31 3.5 D63562-1|BAA09791.1| 1600|Homo sapiens a6(IV) collagen protein. 31 3.5 AL136080-2|CAI40758.1| 1691|Homo sapiens collagen type IV alpha ... 31 3.5 AL136080-1|CAI40756.1| 1690|Homo sapiens collagen type IV alpha ... 31 3.5 AL109943-2|CAI42995.1| 1691|Homo sapiens collagen type IV alpha ... 31 3.5 AL109943-1|CAI42993.1| 1690|Homo sapiens collagen type IV alpha ... 31 3.5 AL034369-3|CAI42047.1| 1691|Homo sapiens collagen type IV alpha ... 31 3.5 AL034369-2|CAI42045.1| 1690|Homo sapiens collagen type IV alpha ... 31 3.5 AL031177-13|CAI43140.1| 1691|Homo sapiens collagen type IV alpha... 31 3.5 AL031177-12|CAI43139.1| 1690|Homo sapiens collagen type IV alpha... 31 3.5 >M69008-1|AAA52754.1| 623|Homo sapiens alpha-1 type XIII collagen protein. Length = 623 Score = 32.7 bits (71), Expect = 0.86 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 170 YHARVANSLKNLFTLLLKNPKFPGIPWETRPLGAQSIPG 286 Y+ + +L+ + TL L P PG+P + P GA IPG Sbjct: 353 YNGNINEALQEILTLALMGP--PGLPGQIGPPGAPGIPG 389 >AL138925-3|CAI15452.1| 683|Homo sapiens collagen type XIII alpha 1 protein. Length = 683 Score = 31.5 bits (68), Expect = 2.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 170 YHARVANSLKNLFTLLLKNPKFPGIPWETRPLGAQSIPG 286 Y+ + +L+ + TL L P PG+P + P GA IPG Sbjct: 424 YNGNINEALQEIRTLALMGP--PGLPGQIGPPGAPGIPG 460 >AL138925-2|CAI15451.2| 695|Homo sapiens collagen type XIII alpha 1 protein. Length = 695 Score = 31.5 bits (68), Expect = 2.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 170 YHARVANSLKNLFTLLLKNPKFPGIPWETRPLGAQSIPG 286 Y+ + +L+ + TL L P PG+P + P GA IPG Sbjct: 424 YNGNINEALQEIRTLALMGP--PGLPGQIGPPGAPGIPG 460 >AL138925-1|CAI15450.1| 717|Homo sapiens collagen type XIII alpha 1 protein. Length = 717 Score = 31.5 bits (68), Expect = 2.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 170 YHARVANSLKNLFTLLLKNPKFPGIPWETRPLGAQSIPG 286 Y+ + +L+ + TL L P PG+P + P GA IPG Sbjct: 446 YNGNINEALQEIRTLALMGP--PGLPGQIGPPGAPGIPG 482 >AJ293624-1|CAC00688.1| 717|Homo sapiens type XIII collagen protein. Length = 717 Score = 31.5 bits (68), Expect = 2.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 170 YHARVANSLKNLFTLLLKNPKFPGIPWETRPLGAQSIPG 286 Y+ + +L+ + TL L P PG+P + P GA IPG Sbjct: 446 YNGNINEALQEIRTLALMGP--PGLPGQIGPPGAPGIPG 482 >U47004-2|AAB19039.1| 1690|Homo sapiens collagen type IV a6 chain protein. Length = 1690 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1292 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1324 >U47004-1|AAB19038.1| 1691|Homo sapiens collagen type IV a6 chain protein. Length = 1691 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1293 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1325 >U04845-1|AAA19569.2| 1691|Homo sapiens A type IV collagen protein. Length = 1691 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1293 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1325 >D63562-1|BAA09791.1| 1600|Homo sapiens a6(IV) collagen protein. Length = 1600 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1288 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1320 >AL136080-2|CAI40758.1| 1691|Homo sapiens collagen type IV alpha 6 protein. Length = 1691 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1293 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1325 >AL136080-1|CAI40756.1| 1690|Homo sapiens collagen type IV alpha 6 protein. Length = 1690 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1292 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1324 >AL109943-2|CAI42995.1| 1691|Homo sapiens collagen type IV alpha 6 protein. Length = 1691 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1293 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1325 >AL109943-1|CAI42993.1| 1690|Homo sapiens collagen type IV alpha 6 protein. Length = 1690 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1292 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1324 >AL034369-3|CAI42047.1| 1691|Homo sapiens collagen type IV alpha 6 protein. Length = 1691 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1293 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1325 >AL034369-2|CAI42045.1| 1690|Homo sapiens collagen type IV alpha 6 protein. Length = 1690 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1292 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1324 >AL031177-13|CAI43140.1| 1691|Homo sapiens collagen type IV alpha 6 protein. Length = 1691 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1293 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1325 >AL031177-12|CAI43139.1| 1690|Homo sapiens collagen type IV alpha 6 protein. Length = 1690 Score = 30.7 bits (66), Expect = 3.5 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +2 Query: 224 NPKFPGIPWETRPLGAQSIPGSFTG*NSPETGLSG 328 +P FPGIP P G Q IPG F+G E GL G Sbjct: 1292 DPGFPGIPGPKGPKGDQGIPG-FSG-LPGELGLKG 1324 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,452,828 Number of Sequences: 237096 Number of extensions: 2215097 Number of successful extensions: 6505 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 5705 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6483 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5364536570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -