BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M20 (183 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41020-2|AAA82332.3| 1732|Caenorhabditis elegans Osmotic avoidan... 29 0.44 DQ360811-1|ABC88648.1| 1737|Caenorhabditis elegans intraflagella... 29 0.44 U23178-1|AAK68301.1| 1280|Caenorhabditis elegans Guanylyl cyclas... 27 1.8 >U41020-2|AAA82332.3| 1732|Caenorhabditis elegans Osmotic avoidance abnormal protein1 protein. Length = 1732 Score = 29.1 bits (62), Expect = 0.44 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 57 VPQIAGKAARALPRYTDIIVADVAYYACGNVIRAEG 164 V ++ K + +L RYTDI+VAD +Y G + G Sbjct: 1541 VQKLCLKQSLSLLRYTDILVADRIFYEAGAAAKDYG 1576 >DQ360811-1|ABC88648.1| 1737|Caenorhabditis elegans intraflagellar transport protein protein. Length = 1737 Score = 29.1 bits (62), Expect = 0.44 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 57 VPQIAGKAARALPRYTDIIVADVAYYACGNVIRAEG 164 V ++ K + +L RYTDI+VAD +Y G + G Sbjct: 1546 VQKLCLKQSLSLLRYTDILVADRIFYEAGAAAKDYG 1581 >U23178-1|AAK68301.1| 1280|Caenorhabditis elegans Guanylyl cyclase protein 12 protein. Length = 1280 Score = 27.1 bits (57), Expect = 1.8 Identities = 10/31 (32%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +3 Query: 15 HRAIQAVTLLMALHV-PQIAGKAARALPRYT 104 HR+ + + + + +H P +AG + +PRYT Sbjct: 1115 HRSCEPLMIRIGMHTGPCVAGVVGKTMPRYT 1145 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,918,536 Number of Sequences: 27780 Number of extensions: 57874 Number of successful extensions: 183 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 183 length of database: 12,740,198 effective HSP length: 41 effective length of database: 11,601,218 effective search space used: 220423142 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -