SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0006_M19
         (513 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.       25   0.40 

>U09586-3|AAC47272.1|  470|Tribolium castaneum integrase protein.
          Length = 470

 Score = 25.0 bits (52), Expect = 0.40
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 4/64 (6%)
 Frame = -3

Query: 292 HFGLTKLADSIFFNPAWTNLF--ISSILIS--VGTNLDSFWRPSLGPTS*ILMSGTLVLI 125
           HFG TK+ +S+     W N++  I   L S  +     S  RP  GP + IL      L+
Sbjct: 142 HFGATKVYNSMKREYYWPNMYRTIKKRLRSCDLCQKTKSSNRPHQGPLTPILYDHIGDLV 201

Query: 124 CFKF 113
           C  F
Sbjct: 202 CVDF 205


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 106,282
Number of Sequences: 336
Number of extensions: 2160
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 12258909
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -