BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M19 (513 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 25 1.5 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 23 6.1 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 25.0 bits (52), Expect = 1.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -2 Query: 317 YTITHLLHPFWTDKACGFN 261 YTIT L+ +W D+ FN Sbjct: 42 YTITMYLNQYWKDERLAFN 60 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 23.0 bits (47), Expect = 6.1 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 148 MSGTLVLICFKFEIDLMAFKLIILVYCFIVR 56 M GTL + F E L+ L +L Y +VR Sbjct: 1 MLGTLASLLFSLEGVLLVALLALLYYYVVVR 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 459,713 Number of Sequences: 2352 Number of extensions: 8174 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 46514490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -