BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M18 (466 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 2.8 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 3.7 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 3.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.7 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 21 4.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 4.9 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.5 AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 21 8.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 8.6 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 8.6 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.2 bits (45), Expect = 2.8 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = -1 Query: 427 LVEGHNLSEIVNESNE 380 ++ G L+EI+NE++E Sbjct: 45 IINGKKLTEIINETHE 60 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -1 Query: 214 IIHFTLDEINCHVRVHIIIGFTDSHLDRIVFIHRVIRN 101 I+ F L I C + + D +DRI+ R++ N Sbjct: 5 ILLFVLVTITCVIAEDYTTKYDDMDIDRILQNGRILTN 42 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 21.8 bits (44), Expect = 3.7 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -1 Query: 214 IIHFTLDEINCHVRVHIIIGFTDSHLDRIVFIHRVIRN 101 I+ F L I C + + D +DRI+ R++ N Sbjct: 5 ILLFVLVTITCVIAEDYTTKYDDMDIDRILQNGRILTN 42 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 3.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 20 TRIPGVRYGPVASTPTRG 73 T + GV Y PV TP+ G Sbjct: 838 TTMAGVIYPPVIGTPSTG 855 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/19 (36%), Positives = 16/19 (84%) Frame = +2 Query: 233 FKSTIKDALIKLNDLVDES 289 FK+ ++ LIK++D+++E+ Sbjct: 221 FKNLPEETLIKISDVLEET 239 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 4.9 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 179 MTVDFVKGKMDN 214 M+VDF+KG + N Sbjct: 184 MSVDFIKGSISN 195 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 6.5 Identities = 18/71 (25%), Positives = 29/71 (40%) Frame = +2 Query: 251 DALIKLNDLVDESDPDTNLPNIVHAFQTAERIREDHPDDDWFHLIGLIHDLGKVMAFYEE 430 D KLN+ +D++D N P + F+ + +D DL FYE+ Sbjct: 1383 DVRAKLNEYLDKADVIVNTPIMDAHFKDVKLSDFGFSTEDILDTAD--EDLLINNVFYED 1440 Query: 431 PQWCVVGDTFA 463 C++ T A Sbjct: 1441 ETSCMLDKTRA 1451 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 278 VDESDPDTNLPNIVHA 325 +D+SDPD + VH+ Sbjct: 119 IDDSDPDPSSEPTVHS 134 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 278 VDESDPDTNLPNIVHA 325 +D+SDPD + VH+ Sbjct: 567 IDDSDPDPSSEPTVHS 582 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 20.6 bits (41), Expect = 8.6 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -1 Query: 184 CHVRVHIIIGFTDSHLDRIVFIHRVIRNA 98 C ++H+ T +HL +I H + NA Sbjct: 151 CAPKLHVFDLKTSNHLKQIEIPHDIAVNA 179 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,156 Number of Sequences: 438 Number of extensions: 2936 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -