BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M16 (378 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 2.1 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 22 6.5 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.8 bits (49), Expect = 2.1 Identities = 8/28 (28%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = +1 Query: 265 PYQRYYGGNEFIDEIEIL-AQNRSLETY 345 PY+ Y G N +++++L ++N++ T+ Sbjct: 479 PYEEYVGSNPNFEQMQVLVSRNKARPTF 506 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.2 bits (45), Expect = 6.5 Identities = 8/32 (25%), Positives = 15/32 (46%) Frame = +1 Query: 268 YQRYYGGNEFIDEIEILAQNRSLETYKLNPEE 363 Y Y+GG+ +E +N ++ NP + Sbjct: 758 YTSYFGGSPSFTNLENSTRNLDMQELDYNPSK 789 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 398,857 Number of Sequences: 2352 Number of extensions: 8098 Number of successful extensions: 55 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 55 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 28646721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -