BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M14 (510 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.55 SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) 31 0.73 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.96 SB_42912| Best HMM Match : K_tetra (HMM E-Value=7.20267e-43) 29 2.2 SB_51336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) 28 3.9 SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) 27 9.0 >SB_22765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1387 Score = 31.1 bits (67), Expect = 0.55 Identities = 31/122 (25%), Positives = 49/122 (40%), Gaps = 4/122 (3%) Frame = +2 Query: 77 VIFCYREVISFSLIKHSFRKTSVTKLCNIVYYLKKMTVIY-TLGFLCLLSTVLGVHVSNL 253 + + YR +S + I +R T + +Y L + V + +L C T G V N Sbjct: 748 IYYLYRLPVSTTCIDFLYRLPVSTTCIDFLYRLPVIRVDWRSLKRQCHRFTS-GRLVDNC 806 Query: 254 NESCIR---CLCYVTGCDLSHKCTGGYCGPFYISRVYWVDAGKPTLPDDDPNRKEAFEDC 424 C + C+ CD SH G C P+ IS +A DD P++ +D Sbjct: 807 VNGCSKHGKCIRGFCICDHSHYFNGAECAPYKISHRPCPEACAKRCTDDCPDKCCKVQDA 866 Query: 425 AR 430 + Sbjct: 867 TK 868 >SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) Length = 437 Score = 30.7 bits (66), Expect = 0.73 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 200 LGFLCLLSTVLGVHVSNLNESCIRCLCYVTGC 295 +G CLL +++G++ + C R CY + C Sbjct: 123 IGVACLLVSLIGLYTPSYRSPCYRSACYRSAC 154 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 30.3 bits (65), Expect = 0.96 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 333 LSTYPGYTGSMRGNQRCLMTTLTEKKPLKTA 425 L T P Y S GN+ C MT +K P+K A Sbjct: 1447 LITSPNYPESYPGNELCNMTIKVDKGPIKVA 1477 >SB_42912| Best HMM Match : K_tetra (HMM E-Value=7.20267e-43) Length = 523 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 344 SRVYWVDAGKPTLPDDDPNRKEAFED 421 +R+YW+ LP+ DPN E F D Sbjct: 307 TRLYWITENGTQLPEFDPNTSEFFFD 332 >SB_51336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 28.3 bits (60), Expect = 3.9 Identities = 18/48 (37%), Positives = 25/48 (52%) Frame = +2 Query: 323 YCGPFYISRVYWVDAGKPTLPDDDPNRKEAFEDCARDYHCSIRIIENH 466 YC P SR W+ +G PT D + K FED A + C + + +NH Sbjct: 204 YCWPIDKSRTTWISSGGPT---DLISNKWMFEDPA--FSC-LAVKKNH 245 >SB_7527| Best HMM Match : DSL (HMM E-Value=2.5e-34) Length = 542 Score = 28.3 bits (60), Expect = 3.9 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 418 FKGFFSVRVVIRQRWFPRIDPVYPGY-VERSAITSS 314 +KGF SVR+ I+ + +P D G+ ++RS SS Sbjct: 174 WKGFLSVRITIKDQDYPSRDDFVDGFLIQRSLPPSS 209 >SB_12975| Best HMM Match : Zona_pellucida (HMM E-Value=6.6e-12) Length = 515 Score = 27.1 bits (57), Expect = 9.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +2 Query: 272 CLCYVTGCDLSHKCTGGYCGPFYISRVY 355 C Y + CD S CG FYI +Y Sbjct: 78 CFRYSSCCDYSQNVNVRNCGGFYIYEIY 105 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,061,314 Number of Sequences: 59808 Number of extensions: 353917 Number of successful extensions: 826 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 825 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1123894172 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -