BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M14 (510 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 2.4 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 2.4 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 23 2.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 5.6 EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isome... 21 7.4 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 7.4 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 2.4 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = -3 Query: 427 SAVFKGFFSVRVVIRQRW----FPRIDPVYPGYVERSAITSSA 311 S +F FS+ V+ R FP I +YP Y S++ A Sbjct: 137 SGMFTTAFSIAVLYRPDTKYMKFPAIYEIYPNYFFDSSVIEEA 179 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 22.6 bits (46), Expect = 2.4 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 4/43 (9%) Frame = -3 Query: 427 SAVFKGFFSVRVVIRQRW----FPRIDPVYPGYVERSAITSSA 311 S +F FS+ V+ R FP I +YP Y S++ A Sbjct: 137 SGMFTTAFSIAVLYRPDTKYMKFPAIYEIYPNYFFDSSVIEEA 179 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.6 bits (46), Expect = 2.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 297 ICHTNALEVIADLSTYPGYTGSMRGNQRC 383 I T +E+I +L +P Y R Q C Sbjct: 331 IGETMPMELIENLRNHPEYIDETRNYQEC 359 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 5.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 185 TVIYTLGFLCLLSTVL 232 T + FLCL ST+L Sbjct: 8 TTLINAAFLCLASTIL 23 >EF493864-1|ABP65286.1| 247|Apis mellifera triosephoshpate isomerase protein. Length = 247 Score = 21.0 bits (42), Expect = 7.4 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 27 DIISARSSRKLDTGVDL*SFVIVRSSAFP*LNIVFAKQVLPNSV 158 DI+ LD+ V+ V+V P + + +AK +LPN++ Sbjct: 22 DIVGFLKKGPLDSNVE----VVV---GVPSIYLTYAKNILPNNI 58 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 7.4 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 433 IPSAVFKGFFSVRVVIRQRWFP 368 IP+ V+ G F R ++ + W P Sbjct: 338 IPAPVYYGNFPPRPIMVRPWVP 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,343 Number of Sequences: 438 Number of extensions: 3090 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14109465 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -