BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M14 (510 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g35670.1 68418.m04261 calmodulin-binding family protein conta... 31 0.34 At3g17225.1 68416.m02200 invertase/pectin methylesterase inhibit... 29 2.4 At3g17230.1 68416.m02201 invertase/pectin methylesterase inhibit... 28 4.2 At1g77620.1 68414.m09037 expressed protein 28 4.2 At5g04370.1 68418.m00429 S-adenosyl-L-methionine:carboxyl methyl... 27 5.5 At1g34370.2 68414.m04268 zinc finger (C2H2 type) family protein ... 27 5.5 At1g34370.1 68414.m04267 zinc finger (C2H2 type) family protein ... 27 5.5 At1g15165.1 68414.m01813 U-box domain-containing protein contain... 27 5.5 At5g16300.2 68418.m01906 expressed protein 27 7.3 At5g16300.1 68418.m01905 expressed protein 27 7.3 At1g55770.1 68414.m06385 invertase/pectin methylesterase inhibit... 27 9.7 At1g13580.1 68414.m01592 longevity-assurance (LAG1) family prote... 27 9.7 >At5g35670.1 68418.m04261 calmodulin-binding family protein contains IQ calmodulin-binding motif, Pfam:PF00612 Length = 442 Score = 31.5 bits (68), Expect = 0.34 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = -3 Query: 118 NQGKADDLTITKDHRSTPVSS--FRDDRALIISKVFR 14 NQ +A + I K H++TP+S +D A+II FR Sbjct: 135 NQSEATETHIPKKHQTTPISKLFLEEDAAVIIQSAFR 171 >At3g17225.1 68416.m02200 invertase/pectin methylesterase inhibitor family protein similar to SP|P83326 Pectinesterase inhibitor (Pectin methylesterase inhibitor) (PMEI) {Actinidia chinensis}; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 185 Score = 28.7 bits (61), Expect = 2.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 392 DPNRKEAFEDCARDYHCSIRIIE 460 DP K FE C RDY +I+ IE Sbjct: 100 DPTLKIPFETCVRDYEGAIKAIE 122 >At3g17230.1 68416.m02201 invertase/pectin methylesterase inhibitor family protein similar to SP|P83326 Pectinesterase inhibitor (Pectin methylesterase inhibitor) (PMEI) {Actinidia chinensis}; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 351 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +2 Query: 392 DPNRKEAFEDCARDYHCSIRIIE 460 DP + ++E C RDY +I+ IE Sbjct: 100 DPTLRTSYETCVRDYEGAIKAIE 122 >At1g77620.1 68414.m09037 expressed protein Length = 1151 Score = 27.9 bits (59), Expect = 4.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +2 Query: 353 YWVDAGKPTLPDDDPNRKEAFEDCARDYHCS 445 YW D K T P DP+R E E Y S Sbjct: 759 YWPDMQKETNPLADPSRAEILEAACYQYETS 789 >At5g04370.1 68418.m00429 S-adenosyl-L-methionine:carboxyl methyltransferase family protein similar to SAM:salicylic acid carboxyl methyltransferase (SAMT) [GI:6002712][Clarkia breweri] and to SAM:benzoic acid carboxyl methyltransferase (BAMT)[GI:9789277][Antirrhinum majus] Length = 396 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +2 Query: 380 LPDDDPNRKEAFEDCARDYHCSIRIIENHMATFGKDCNSD 499 LP DPN KE E ++ IR +E H G CN D Sbjct: 288 LPFYDPNEKEIKEMVQKEGSFEIRDLETHGYDLG-HCNQD 326 >At1g34370.2 68414.m04268 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 499 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 300 CHTNALEVIADLSTYPGYTGSMRGNQRCLMTTLTEKKPL 416 CHT VIADL T+ + G + C TT + K L Sbjct: 338 CHTKKFSVIADLKTHEKHCGKNKWLCSC-GTTFSRKDKL 375 >At1g34370.1 68414.m04267 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 499 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 300 CHTNALEVIADLSTYPGYTGSMRGNQRCLMTTLTEKKPL 416 CHT VIADL T+ + G + C TT + K L Sbjct: 338 CHTKKFSVIADLKTHEKHCGKNKWLCSC-GTTFSRKDKL 375 >At1g15165.1 68414.m01813 U-box domain-containing protein contains Pfam profile PF04564: U-box domain Length = 295 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = +1 Query: 199 FRIFMFIINSIRSARIKSQRILHPVSVLCNRM*FVTQMHWRLLRTFLHIPGILG 360 FR +F N++ + +L P++ L + F +Q HW+L HI G +G Sbjct: 27 FRTELFFSNAVNLEICVAATVLTPLTPLLG-LYFGSQAHWQLNLFGEHIKGFVG 79 >At5g16300.2 68418.m01906 expressed protein Length = 1034 Score = 27.1 bits (57), Expect = 7.3 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 4/90 (4%) Frame = +1 Query: 127 FSQNKCYQTL*YCLLFKKNDRDLYFRIFMFIINSIRSARIKSQRILHPVSVLCNRM*FVT 306 + QNKCY ++ L D++L F + +++ S+ I P +++ + F+ Sbjct: 562 YVQNKCYDSV--SALLADVDKELEF-----LCAAVKKENKDSEAI--PPAIIIEKSLFMG 612 Query: 307 QMHWRLLRTFLHIPGILGR----CGETNAA 384 ++ + LL H+P ILG C ET A Sbjct: 613 RLLFALLNHSKHVPLILGSPRLWCRETMTA 642 >At5g16300.1 68418.m01905 expressed protein Length = 1068 Score = 27.1 bits (57), Expect = 7.3 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 4/90 (4%) Frame = +1 Query: 127 FSQNKCYQTL*YCLLFKKNDRDLYFRIFMFIINSIRSARIKSQRILHPVSVLCNRM*FVT 306 + QNKCY ++ L D++L F + +++ S+ I P +++ + F+ Sbjct: 562 YVQNKCYDSV--SALLADVDKELEF-----LCAAVKKENKDSEAI--PPAIIIEKSLFMG 612 Query: 307 QMHWRLLRTFLHIPGILGR----CGETNAA 384 ++ + LL H+P ILG C ET A Sbjct: 613 RLLFALLNHSKHVPLILGSPRLWCRETMTA 642 >At1g55770.1 68414.m06385 invertase/pectin methylesterase inhibitor family protein low similarity to SP|Q43111 Pectinesterase 3 precursor (EC 3.1.1.11) (Pectin methylesterase 3) {Phaseolus vulgaris}, SP|P83326 Pectinesterase inhibitor (Pectin methylesterase inhibitor) (PMEI) {Actinidia chinensis}; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 175 Score = 26.6 bits (56), Expect = 9.7 Identities = 9/38 (23%), Positives = 22/38 (57%) Frame = +2 Query: 386 DDDPNRKEAFEDCARDYHCSIRIIENHMATFGKDCNSD 499 D +P ++ EDC +DY ++ +++ ++ D ++D Sbjct: 87 DLEPAIEDTLEDCQKDYQDAVEQLDDSISAMLADAHTD 124 >At1g13580.1 68414.m01592 longevity-assurance (LAG1) family protein similar to Alternaria stem canker resistance protein (ASC1) [Lycopersicon esculentum] GI:7688742; contains Pfam profile PF03798: Longevity-assurance protein (LAG1) Length = 239 Score = 26.6 bits (56), Expect = 9.7 Identities = 16/56 (28%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 242 VSNLNESCIRCLCYVTGCDLSHKCTGGYCGPFYISRVY-WVDAGKPTLPDDDPNRK 406 + ES +C+ Y++ L+ T Y P++++ Y WV G T PD K Sbjct: 72 IRKFKESAWKCVYYLSAEILALSVT--YNEPWFMNTKYFWVGPGDQTWPDQQTKLK 125 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,884,477 Number of Sequences: 28952 Number of extensions: 223110 Number of successful extensions: 547 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -