BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M13 (457 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0179 + 2034261-2035102,2035215-2035864,2036156-2037234 29 1.3 05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 29 2.3 02_05_0890 - 32546918-32547088,32547224-32547334,32547705-325478... 27 7.2 04_04_1189 + 31586991-31587291,31587358-31587397,31587449-315875... 27 9.5 >10_01_0179 + 2034261-2035102,2035215-2035864,2036156-2037234 Length = 856 Score = 29.5 bits (63), Expect = 1.3 Identities = 17/67 (25%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = +2 Query: 197 HTFMPSALDFYQTALRDPAFYQLYHRIVG-YINAFKHYLKPYPQEKLHFVGVQINDVVVE 373 H S DF + P F +L+H I Y+ ++KPY K+ ++ + + ++ E Sbjct: 641 HIIDHSTDDFLERWFPIPCFLRLFHMITDYYLLQLPKWVKPY-LTKMAYLSINLREIKKE 699 Query: 374 KLVTFFD 394 + T D Sbjct: 700 DMETLGD 706 >05_07_0106 + 27723877-27723978,27724825-27725100,27726103-27727281 Length = 518 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = +3 Query: 24 NRMARKLISTMKRQLTLSETIGKRTPICMKKKLQRIINDLMKLS 155 NR+ R L++ +++ E I + CMKK+ ++N L +S Sbjct: 39 NRLLRSLVNIHEQETYSREIITEAIESCMKKQADNLVNTLDVIS 82 >02_05_0890 - 32546918-32547088,32547224-32547334,32547705-32547884, 32547960-32548064,32548333-32548431,32548524-32548679, 32548772-32548850,32549213-32549278,32549382-32549536, 32549675-32550034,32550150-32550305,32550779-32550856, 32551471-32551812 Length = 685 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +3 Query: 99 PICMKKKLQRIINDLMKLSLAMCSVQHLNHSTSTPSCPVRLT 224 PICM + MC V HL+H + P C LT Sbjct: 61 PICMAVIKDAFLTACGHSFCYMCIVTHLSHKSDCPCCGNYLT 102 >04_04_1189 + 31586991-31587291,31587358-31587397,31587449-31587534, 31587535-31588097,31588250-31589913,31589956-31590066, 31590152-31591181,31591234-31591406,31591535-31591814, 31592275-31592331 Length = 1434 Score = 26.6 bits (56), Expect = 9.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 287 INAFKHYLKPYPQEKLHFVGVQINDVVVEKLVTFFDYSQ 403 IN+ ++ L PY L F+G DVV+ + +T F + Q Sbjct: 639 INSLQNSLNPYHLRYLEFIGA-YGDVVLPQALTSFYHLQ 676 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,513,828 Number of Sequences: 37544 Number of extensions: 228992 Number of successful extensions: 540 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 895500300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -