BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M12 (468 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 34 0.042 At1g26150.1 68414.m03192 protein kinase family protein similar t... 34 0.042 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 31 0.29 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 31 0.29 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 30 0.68 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 30 0.68 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 30 0.90 At5g23490.1 68418.m02756 expressed protein 30 0.90 At1g69810.1 68414.m08032 WRKY family transcription factor 30 0.90 At2g20950.4 68415.m02474 expressed protein 24 1.2 At5g35604.1 68418.m04242 hypothetical protein 29 1.2 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 29 1.6 At1g78815.1 68414.m09187 expressed protein contains Pfam profile... 29 1.6 At5g04720.1 68418.m00482 disease resistance protein (CC-NBS-LRR ... 29 2.1 At4g24020.1 68417.m03452 RWP-RK domain-containing protein simila... 29 2.1 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 29 2.1 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 29 2.1 At5g28490.1 68418.m03466 expressed protein contains Pfam profile... 28 3.6 At4g28690.1 68417.m04099 expressed protein 27 4.8 At3g47330.1 68416.m05144 hypothetical protein contains Pfam prof... 27 4.8 At3g15250.1 68416.m01926 expressed protein ; expression supporte... 27 4.8 At2g38410.1 68415.m04718 VHS domain-containing protein / GAT dom... 27 4.8 At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp... 27 4.8 At3g30230.1 68416.m03820 myosin heavy chain-related similar to M... 27 6.3 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 27 6.3 At2g46370.2 68415.m05771 auxin-responsive GH3 family protein sim... 27 6.3 At2g46370.1 68415.m05770 auxin-responsive GH3 family protein sim... 27 6.3 At1g26460.1 68414.m03227 pentatricopeptide (PPR) repeat-containi... 27 6.3 At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp... 27 6.3 At5g33230.1 68418.m03927 hypothetical protein 27 8.4 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 27 8.4 At3g11000.1 68416.m01328 expressed protein 27 8.4 At1g78800.1 68414.m09184 glycosyl transferase family 1 protein c... 27 8.4 At1g54970.1 68414.m06278 proline-rich family protein similar to ... 27 8.4 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 34.3 bits (75), Expect = 0.042 Identities = 28/92 (30%), Positives = 36/92 (39%) Frame = +2 Query: 35 PRH*PSVNPMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTDAA 214 P H P P++ P PP H+ P V PP+HS P H+ A Sbjct: 546 PVHSPPPPPVYSPPPPPPPVHSPPPPVFSPP---PPVYSPPPPVHSPP--PPVHSPPPPA 600 Query: 215 PRFTPTGRRPPVHSSTGGVPYYTTNVSVYRGP 310 P +P PPVHS P Y+ V+ P Sbjct: 601 PVHSPP---PPVHSPPPPPPVYSPPPPVFSPP 629 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 34.3 bits (75), Expect = 0.042 Identities = 25/71 (35%), Positives = 32/71 (45%) Frame = +2 Query: 35 PRH*PSVNPMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTDAA 214 PRH PS P PSTPPS + E P H R++ PP S PS + +D+ Sbjct: 195 PRHLPS--PPASERPSTPPSDS--EHPSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSK 250 Query: 215 PRFTPTGRRPP 247 P+ PP Sbjct: 251 RPVHPSPPSPP 261 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 31.5 bits (68), Expect = 0.29 Identities = 24/83 (28%), Positives = 31/83 (37%), Gaps = 4/83 (4%) Frame = +2 Query: 83 TPPSHTRYERRVRGPL---SHTVVRDRRPPIHSNGRRPSAHAQTDAAPRFTPTGRRPPVH 253 TPPSHT P S + PP H+ +H T P TPT PP + Sbjct: 47 TPPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCN 106 Query: 254 -SSTGGVPYYTTNVSVYRGPLPN 319 S P ++ S P P+ Sbjct: 107 CGSPPSHPSTPSHPSTPSHPTPS 129 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 31.5 bits (68), Expect = 0.29 Identities = 24/83 (28%), Positives = 31/83 (37%), Gaps = 4/83 (4%) Frame = +2 Query: 83 TPPSHTRYERRVRGPL---SHTVVRDRRPPIHSNGRRPSAHAQTDAAPRFTPTGRRPPVH 253 TPPSHT P S + PP H+ +H T P TPT PP + Sbjct: 47 TPPSHTPPSSNCGSPPYDPSPSTPSHPSPPSHTPTPSTPSHTPTPHTPSHTPTPHTPPCN 106 Query: 254 -SSTGGVPYYTTNVSVYRGPLPN 319 S P ++ S P P+ Sbjct: 107 CGSPPSHPSTPSHPSTPSHPTPS 129 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 30.3 bits (65), Expect = 0.68 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +2 Query: 20 RRGETPRH*PSVNPMHLALPSTPPSHTRYERRVRGP---LSHTVVRDRRPPIHSNGRRPS 190 RRG+TP +P PS+PP RY RG + + VR RR P+ R P Sbjct: 253 RRGDTPPRRRPASPSRGRSPSSPPPR-RYRSPPRGSPRRIRGSPVR-RRSPLPLRRRSPP 310 Query: 191 AHAQTDAAPRFTPTGRR 241 + + PR +P RR Sbjct: 311 PR-RLRSPPRRSPIRRR 326 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 30.3 bits (65), Expect = 0.68 Identities = 26/77 (33%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = +2 Query: 20 RRGETPRH*PSVNPMHLALPSTPPSHTRYERRVRGP---LSHTVVRDRRPPIHSNGRRPS 190 RRG+TP +P PS+PP RY RG + + VR RR P+ R P Sbjct: 260 RRGDTPPRRRPASPSRGRSPSSPPPR-RYRSPPRGSPRRIRGSPVR-RRSPLPLRRRSPP 317 Query: 191 AHAQTDAAPRFTPTGRR 241 + + PR +P RR Sbjct: 318 PR-RLRSPPRRSPIRRR 333 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 29.9 bits (64), Expect = 0.90 Identities = 22/96 (22%), Positives = 32/96 (33%) Frame = +2 Query: 41 H*PSVNPMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTDAAPR 220 H PS +P H PS P+HT P P H+ P+ A Sbjct: 219 HSPSHSPAHT--PSHSPAHTPSHSPAHAPSHSPAHAPSHSPAHAPSHSPAHSPSHSPATP 276 Query: 221 FTPTGRRPPVHSSTGGVPYYTTNVSVYRGPLPNTNS 328 +P+ P S P + S P P+ ++ Sbjct: 277 KSPSPSSSPAQSPATPSPMTPQSPSPVSSPSPDQSA 312 >At5g23490.1 68418.m02756 expressed protein Length = 729 Score = 29.9 bits (64), Expect = 0.90 Identities = 19/71 (26%), Positives = 31/71 (43%) Frame = +2 Query: 56 NPMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTDAAPRFTPTG 235 +P H + TPP H ++ P+S TVV D + P + + + + +P +P Sbjct: 439 SPAHKKVDETPPKHVQFLE----PISKTVVDDAQNPSYGSAFDDPSSSN---SPLLSPVF 491 Query: 236 RRPPVHSSTGG 268 P S GG Sbjct: 492 EEPSSSFSEGG 502 >At1g69810.1 68414.m08032 WRKY family transcription factor Length = 387 Score = 29.9 bits (64), Expect = 0.90 Identities = 23/68 (33%), Positives = 28/68 (41%), Gaps = 1/68 (1%) Frame = +1 Query: 52 SESDAFSSPLNSPLTH-TLRTTRARPLVTYRGSRPPPPNTLQRAAPLXXXXXXXXXXVHS 228 S S + S P H ++ TT + P VT +RP PN L PL S Sbjct: 289 SSSTSASLSYFFPFHHFSISTTNSHPTVTLDLTRPNYPNQLPDDYPLSSSSFSLNFS--S 346 Query: 229 NGPAPPSS 252 P PPSS Sbjct: 347 PDPPPPSS 354 >At2g20950.4 68415.m02474 expressed protein Length = 530 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 158 PPIHSNGRRPSAHAQTDAAPRFTPTGRRPPVHSSTGGVPYYTTNVSVYR 304 PP +S+ + T P TGRR S + V ++ + VS+Y+ Sbjct: 226 PPFYSSSDDEDDNNSTYLFPEIA-TGRRSRGVSGSSTVRFFLSRVSIYQ 273 Score = 23.8 bits (49), Expect(2) = 1.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 32 TPRH*PSVNPMHLALPSTPPSHTRYERRVRG 124 T R+ PS +P H + +PP H R +R G Sbjct: 162 TSRNRPS-SPFHPSQSRSPPPHARTQRYNNG 191 >At5g35604.1 68418.m04242 hypothetical protein Length = 298 Score = 29.5 bits (63), Expect = 1.2 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 5/41 (12%) Frame = +2 Query: 152 RRPPI-HSNGRRPSAHAQTDAAPRFTPTGRR----PPVHSS 259 RRP +S+ RR A A+TD +PR +P R PPV +S Sbjct: 72 RRPSRGNSSPRRDKARARTDCSPRLSPPSRTMGPPPPVATS 112 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 29.1 bits (62), Expect = 1.6 Identities = 30/105 (28%), Positives = 42/105 (40%), Gaps = 3/105 (2%) Frame = +2 Query: 32 TPRH*PSVNPMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTDA 211 TP + P V P + P TP Y ++ P H PI+S +P QT Sbjct: 227 TPTYSPPVKPPPVHKPPTPI----YSPPIKPPPVHKPPT----PIYSPPVKPPP-VQTPP 277 Query: 212 APRFTPTGRRPPVHSSTGGVPYYTTNVS---VYRGPLPNTNSVFK 337 P ++P + PPVH P Y+ V V + P P + K Sbjct: 278 TPIYSPPVKPPPVHKPP--TPTYSPPVKSPPVQKPPTPTYSPPIK 320 >At1g78815.1 68414.m09187 expressed protein contains Pfam profile PF04852: Protein of unknown function (DUF640) Length = 195 Score = 29.1 bits (62), Expect = 1.6 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Frame = +2 Query: 5 GVAGGRRGETPRH*PSVNPMHLALPSTPPSHTRYERRVRGPLSH--TVVRDRRPPIH 169 G+A G P+ P P P PP+ +RYE + R + +R+++PP+H Sbjct: 10 GIAEG--SSQPQSQPQPQPHQPQSPPNPPALSRYESQKRRDWNTFCQYLRNQQPPVH 64 >At5g04720.1 68418.m00482 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 811 Score = 28.7 bits (61), Expect = 2.1 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 272 PYYTTNVSVYRGPLPNTNSVFKEAVRRGFLLLFFSSKSYIL-HFISKTLKL 421 PY VS++ G + + E + L+L FSS Y+L FI+K KL Sbjct: 525 PYKARVVSIHTGEMTQMDWFDMELPKAEVLILHFSSDKYVLPPFIAKMGKL 575 >At4g24020.1 68417.m03452 RWP-RK domain-containing protein similar to nodule inception protein [Lotus japonicus] GI:6448579; contains Pfam profile: PF02042 RWP-RK domain Length = 959 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +2 Query: 185 PSAHAQTDAAPRFTPTGRRPPVHSSTGGVP 274 P H QT A P +P G +PP +T P Sbjct: 671 PWTHGQTSAQPLNSPNGSKPPELPNTNNSP 700 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 28.7 bits (61), Expect = 2.1 Identities = 21/74 (28%), Positives = 28/74 (37%) Frame = +2 Query: 29 ETPRH*PSVNPMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTD 208 E H P +P+H + P PPS E P+ H PP+ + P Q+ Sbjct: 676 EVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVH---HSPPPPMVHHSPPPPVIHQSP 732 Query: 209 AAPRFTPTGRRPPV 250 P G PPV Sbjct: 733 PPPSPEYEGPLPPV 746 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 28.7 bits (61), Expect = 2.1 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 70 SSPLNSPLTHTLRTTRARPLVTY-RGSRPPPPNTLQRAAP 186 S P +P T+R + P V+ GSRPPPP++ +P Sbjct: 61 SGPPPAPPVGTMRPGQPSPFVSQIPGSRPPPPSSNSFPSP 100 >At5g28490.1 68418.m03466 expressed protein contains Pfam profile PF04852: Protein of unknown function (DUF640) Length = 190 Score = 27.9 bits (59), Expect = 3.6 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = +2 Query: 41 H*PSVNPMHLALPSTPPSHTRYERRVRGPLSH--TVVRDRRPPI 166 H P+ NP + + TPPS +RYE + R + +R+ RPP+ Sbjct: 6 HQPNKNP-NSSTQLTPPSSSRYENQKRRDWNTFCQYLRNHRPPL 48 >At4g28690.1 68417.m04099 expressed protein Length = 448 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/46 (32%), Positives = 21/46 (45%) Frame = +2 Query: 158 PPIHSNGRRPSAHAQTDAAPRFTPTGRRPPVHSSTGGVPYYTTNVS 295 PP+ S G +P+ A A+ PT PPV S T ++S Sbjct: 316 PPVASQGSQPTCCAPPVASQGSQPTRYAPPVASQGNAQRIVTGSIS 361 >At3g47330.1 68416.m05144 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 664 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 88 PLTHTLRTTRARPLVTYRGSRPPPPNTLQ 174 PL++ R T+++ LV + G R P P T++ Sbjct: 575 PLSYQPRDTQSKALVIHSGIRDPAPPTIE 603 >At3g15250.1 68416.m01926 expressed protein ; expression supported by MPSS Length = 217 Score = 27.5 bits (58), Expect = 4.8 Identities = 19/47 (40%), Positives = 22/47 (46%) Frame = -1 Query: 270 TPPVEE*TGGRRPVGVNRGAASV*A*AEGRRPLECIGGRRSRTTVCD 130 TP +GG R G + A V E RR + CIGG S T CD Sbjct: 168 TPVPVRMSGGIRVGGRKKKAVRVRKKTEERRRVSCIGGSLSET--CD 212 >At2g38410.1 68415.m04718 VHS domain-containing protein / GAT domain-containing protein weak similarity to hepatocyte growth factor-regulated tyrosine kinase substrate HRS isoform 2 [Homo sapiens] GI:9022389; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 671 Score = 27.5 bits (58), Expect = 4.8 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +2 Query: 41 H*PSVNPMHLALPSTPPS-HTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTDAAP 217 H + N + LALP PP +T E+ + LS T+ PP S+ P A +D Sbjct: 406 HNAASNALALALPDPPPPVNTTKEQDMIDLLSITLCTPSTPPAPSSQPSPPPPAGSDQNT 465 Query: 218 RFTP 229 P Sbjct: 466 HIYP 469 >At1g14650.1 68414.m01741 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein / ubiquitin family protein similar to SP|Q15459 Splicing factor 3 subunit 1 (Spliceosome associated protein 114) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01805: Surp module Length = 785 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = +2 Query: 59 PMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPP 163 P L +P P H +++ + GP H + RPP Sbjct: 581 PRPLGVPMMQPMHQQHQLTMPGPPGHPQMMMNRPP 615 >At3g30230.1 68416.m03820 myosin heavy chain-related similar to Myosin heavy chain, non-muscle (Zipper protein) (Myosin II)(SP:Q99323) {Drosophila melanogaster} Length = 527 Score = 27.1 bits (57), Expect = 6.3 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Frame = +2 Query: 146 RDRRPPIHSNGRRPSAHAQTDAAPRFT--PTGRRPPVHSSTGGVP 274 RDR +S+ RR + A+TD +PR + P PP+ T P Sbjct: 197 RDRSARGNSSPRREKSKARTDRSPRLSLPPRSMGPPLPVVTSPPP 241 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 27.1 bits (57), Expect = 6.3 Identities = 24/96 (25%), Positives = 35/96 (36%) Frame = +2 Query: 29 ETPRH*PSVNPMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTD 208 ETP+ P +P P T + PL V D RRP + + Sbjct: 574 ETPK--PEESPKPQPPKQEQPPKTEAPKMGSPPLESPVPNDPYDASPIKKRRPQPPSPST 631 Query: 209 AAPRFTPTGRRPPVHSSTGGVPYYTTNVSVYRGPLP 316 + T + + PPVHS P ++ V+ P P Sbjct: 632 EETK-TTSPQSPPVHSPPPPPPVHSPPPPVFSPPPP 666 >At2g46370.2 68415.m05771 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 27.1 bits (57), Expect = 6.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 257 STGGVPYYTTNVSVYRGP 310 STGGVP T +VYR P Sbjct: 156 STGGVPVGTATTNVYRNP 173 >At2g46370.1 68415.m05770 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 575 Score = 27.1 bits (57), Expect = 6.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 257 STGGVPYYTTNVSVYRGP 310 STGGVP T +VYR P Sbjct: 156 STGGVPVGTATTNVYRNP 173 >At1g26460.1 68414.m03227 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 630 Score = 27.1 bits (57), Expect = 6.3 Identities = 19/57 (33%), Positives = 24/57 (42%) Frame = +2 Query: 191 AHAQTDAAPRFTPTGRRPPVHSSTGGVPYYTTNVSVYRGPLPNTNSVFKEAVRRGFL 361 A TD P + P + G P Y N +R P+PNT S + V GFL Sbjct: 44 ATESTDHDPSNHQSTSTPLPPNPATGSPLYQEN---WRSPIPNTPSFNQSLVPLGFL 97 >At1g14640.1 68414.m01740 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein similar to human splicing factor GB:CAA59494 GI:899298 from [Homo sapiens]; contains Pfam profile PF01805: Surp module Length = 735 Score = 27.1 bits (57), Expect = 6.3 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 6/78 (7%) Frame = +2 Query: 35 PRH*PSVN----PMHLALPSTPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRR--PSAH 196 PR PSV P L +P P + +++ + GP H + RPP R P Sbjct: 557 PRPPPSVQYPGAPRPLGVPMMQPMYQQHQLSMSGPHGHPSMMMSRPPQMQPVMRVPPPPG 616 Query: 197 AQTDAAPRFTPTGRRPPV 250 +Q P G+ PP+ Sbjct: 617 SQFSHMQVPQPYGQLPPL 634 >At5g33230.1 68418.m03927 hypothetical protein Length = 126 Score = 26.6 bits (56), Expect = 8.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +1 Query: 88 PLTHTLRTTRARPLVTYRGSRPPPPNTLQ 174 P ++ R T+++ LV + GSR P P T++ Sbjct: 32 PPSYQPRDTQSKALVIHSGSRDPVPPTIE 60 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 26.6 bits (56), Expect = 8.4 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 161 PIHSNGRRPSAHAQTDAAPRFTPTGRRPPVHSSTGGVPYY 280 P N P + P T PP SS+GG PYY Sbjct: 40 PCQPNPSPPPPPSNPSPPPPSPTTTACPPPPSSSGGGPYY 79 >At3g11000.1 68416.m01328 expressed protein Length = 488 Score = 26.6 bits (56), Expect = 8.4 Identities = 16/62 (25%), Positives = 24/62 (38%) Frame = +2 Query: 83 TPPSHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTDAAPRFTPTGRRPPVHSST 262 T PS ++ LSH + +S S+ A +T R PP+H + Sbjct: 232 TQPSVSQSGTSYSSALSHMTASSTQEKKNSITNEGSSQACKGVENPWTSAARVPPIHQDS 291 Query: 263 GG 268 GG Sbjct: 292 GG 293 >At1g78800.1 68414.m09184 glycosyl transferase family 1 protein contains similarity to glycosyltransferase GI:871530 from [Saccharomyces cerevisiae], Alg2 mannosyltransferase [gi:3868942] from Rhizomucor pusillus; contains Pfam profile: PF00534 Glycosyl transferases group 1 Length = 403 Score = 26.6 bits (56), Expect = 8.4 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = +3 Query: 318 IPTQYSKRPCAAVFYCYF---FLLNHTYYI--LFQKPLSF 422 +P KR VFYC+F L HT + +++KP+ F Sbjct: 114 VPLLKLKRSSKVVFYCHFPDLLLAKHTTTLRRMYRKPIDF 153 >At1g54970.1 68414.m06278 proline-rich family protein similar to proline-rich protein GI:170048 from [Glycine max] Length = 335 Score = 26.6 bits (56), Expect = 8.4 Identities = 22/85 (25%), Positives = 33/85 (38%), Gaps = 2/85 (2%) Frame = +2 Query: 35 PRH*PSVNPMHLALPSTPP--SHTRYERRVRGPLSHTVVRDRRPPIHSNGRRPSAHAQTD 208 P H P++ P P P S Y + P ++T +P + + P + T Sbjct: 50 PVHKPTLPPPVYTPPVHKPTLSPPVYTKPTLPPPAYTPPVYNKPTLPAPVYTPPVYKPTL 109 Query: 209 AAPRFTPTGRRPPVHSSTGGVPYYT 283 + P +T PPV T P YT Sbjct: 110 SPPVYTKPTLLPPVFKPTLSPPVYT 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,769,680 Number of Sequences: 28952 Number of extensions: 289185 Number of successful extensions: 988 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 981 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 791932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -