BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M11 (492 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81070-1|CAB02997.1| 137|Caenorhabditis elegans Hypothetical pr... 27 7.4 AL132876-3|CAD21657.2| 746|Caenorhabditis elegans Hypothetical ... 27 7.4 >Z81070-1|CAB02997.1| 137|Caenorhabditis elegans Hypothetical protein F26E4.2 protein. Length = 137 Score = 27.1 bits (57), Expect = 7.4 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +1 Query: 151 QEKADYNAIPLKKRVKEVFFSDPGQQIIKGVIAR 252 QE D +KKR +V +S G++++ GV+ + Sbjct: 23 QEDGDEQIFDVKKRKPQVTYSGDGRRMLDGVVEK 56 >AL132876-3|CAD21657.2| 746|Caenorhabditis elegans Hypothetical protein Y105E8A.3 protein. Length = 746 Score = 27.1 bits (57), Expect = 7.4 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +1 Query: 127 SFNNRLIWQEKADYNAIPLKKRVKEVFFSDPGQQIIKGVIARDLDHTDAIAS 282 S++N +WQ K+D N + +VKE + Q+I+ ++ L T A S Sbjct: 644 SYSNAHMWQHKSDINVASVHVQVKE----EANAQMIRHRVSNILKSTGATHS 691 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,901,639 Number of Sequences: 27780 Number of extensions: 225209 Number of successful extensions: 536 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 924715866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -