BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M10 (447 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q171X1 Cluster: Putative uncharacterized protein; n=1; ... 31 8.6 >UniRef50_Q171X1 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 928 Score = 31.5 bits (68), Expect = 8.6 Identities = 23/96 (23%), Positives = 43/96 (44%) Frame = -1 Query: 321 NRKC*LRIIKNLTYARSNVINFQKII*KYNLGYSFVLVTSIV*RNLKAMN*NVLNARAIW 142 NR+ LR+++ L YA+ V NF + N + F L + RN+++ Sbjct: 125 NRQYKLRVLQALNYAQQAVYNFATTVYDLNRTHDFTLNIVVQVRNVES------RVPIFT 178 Query: 141 LIYANRKTMEKLRNTDTITSLSTILFADDAACYKIR 34 + ++ MEK + TIT++ + CY ++ Sbjct: 179 RPFTTQRIMEKTAFSTTITAIDGDTGLNAPICYDLK 214 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,793,881 Number of Sequences: 1657284 Number of extensions: 8113208 Number of successful extensions: 11939 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 11684 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11937 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 23183027945 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -