BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M10 (447 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0482 - 3714442-3715593 28 3.9 10_01_0315 - 3454846-3455465,3455562-3455663,3455828-3455954,345... 27 9.1 >11_01_0482 - 3714442-3715593 Length = 383 Score = 27.9 bits (59), Expect = 3.9 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 112 FHCFPISVNQPNGPSVEHVLVH--CLEVSLNNTRNEN 216 FHC P S ++ +GPS+ V H + V ++ + EN Sbjct: 77 FHCSPCSKHRVHGPSINVVAAHGDSVLVEMHYEKGEN 113 >10_01_0315 - 3454846-3455465,3455562-3455663,3455828-3455954, 3456698-3456727,3456828-3456877,3457004-3457106 Length = 343 Score = 26.6 bits (56), Expect = 9.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 61 GKQYGRQRCYGVCIT*LFHCFPISVNQPNGPSV 159 G YG+ GVC+ FP ++NQPN PSV Sbjct: 297 GAVYGKHS--GVCLE--TQGFPNAINQPNFPSV 325 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,645,765 Number of Sequences: 37544 Number of extensions: 191834 Number of successful extensions: 256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 256 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 859680288 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -