BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M10 (447 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) 29 2.3 SB_31536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_31791| Best HMM Match : PIG-U (HMM E-Value=0.15) Length = 1366 Score = 28.7 bits (61), Expect = 2.3 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = -1 Query: 99 TDTITSLSTILFADDAACYKIRLLNVTSMLSRL 1 T +IT LS ++FAD++ C K+ ++ + +LS L Sbjct: 116 TRSIT-LSGVVFADNSECLKVEVVGIPRVLSNL 147 >SB_31536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 26.6 bits (56), Expect = 9.3 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 139 QPNGPSVEHVLVHCLEVSLNNTRNENK 219 + G +V H HC +S++NT N+ + Sbjct: 127 ETGGENVRHPKSHCDRISISNTNNDRQ 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,910,185 Number of Sequences: 59808 Number of extensions: 244092 Number of successful extensions: 371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -