Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= I10A02NGRL0006_M10
         (447 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g22860.1 68416.m02882 eukaryotic translation initiation facto...    31   0.35 

>At3g22860.1 68416.m02882 eukaryotic translation initiation factor 3
           subunit 8, putative / eIF3c, putative similar to
           eukaryotic translation initiation factor 3 subunit 8
           (eIF3 p110) [Arabidopsis thaliana] SWISS-PROT:O49160
          Length = 800

 Score = 31.1 bits (67), Expect = 0.35
 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = -1

Query: 168 NVLNARAIWLIYANRKT-MEKLRNTDTITSLSTILFADDAACYK 40
           +VLN+  IW ++ NR + ++ ++ + +  +L T LF   ++CYK
Sbjct: 638 SVLNSLDIWRLFKNRDSILDMVKASISEVALRTYLFTYSSSCYK 681


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,209,873
Number of Sequences: 28952
Number of extensions: 177785
Number of successful extensions: 264
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 264
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 264
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 722638680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)