BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M10 (447 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22860.1 68416.m02882 eukaryotic translation initiation facto... 31 0.35 >At3g22860.1 68416.m02882 eukaryotic translation initiation factor 3 subunit 8, putative / eIF3c, putative similar to eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110) [Arabidopsis thaliana] SWISS-PROT:O49160 Length = 800 Score = 31.1 bits (67), Expect = 0.35 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = -1 Query: 168 NVLNARAIWLIYANRKT-MEKLRNTDTITSLSTILFADDAACYK 40 +VLN+ IW ++ NR + ++ ++ + + +L T LF ++CYK Sbjct: 638 SVLNSLDIWRLFKNRDSILDMVKASISEVALRTYLFTYSSSCYK 681 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,209,873 Number of Sequences: 28952 Number of extensions: 177785 Number of successful extensions: 264 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 264 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -