BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M09 (458 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X94613-1|CAA64319.1| 190|Drosophila melanogaster ribosomal prot... 133 1e-31 BT022718-1|AAY55134.1| 190|Drosophila melanogaster RE74350p pro... 133 1e-31 AE014134-2010|AAF53049.1| 190|Drosophila melanogaster CG6141-PB... 133 1e-31 AE014134-2009|AAF53048.2| 190|Drosophila melanogaster CG6141-PA... 133 1e-31 BT023691-1|AAY85091.1| 68|Drosophila melanogaster IP03664p pro... 33 0.24 AE014134-2103|AAN10787.1| 68|Drosophila melanogaster CG31704-P... 33 0.24 AE014134-2104|AAN10788.1| 79|Drosophila melanogaster CG31758-P... 32 0.32 AY058325-1|AAL13554.1| 662|Drosophila melanogaster GH09510p pro... 32 0.43 AE014296-1453|AAF50418.2| 662|Drosophila melanogaster CG32354-P... 32 0.43 AY052138-1|AAK93562.1| 1071|Drosophila melanogaster SD09502p pro... 29 2.3 AE014296-2453|AAF49684.2| 1071|Drosophila melanogaster CG5392-PA... 29 2.3 AY906258-1|AAX60604.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906257-1|AAX60603.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906256-1|AAX60602.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906255-1|AAX60601.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906254-1|AAX60600.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906253-1|AAX60599.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906252-1|AAX60598.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906251-1|AAX60597.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906250-1|AAX60596.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906249-1|AAX60595.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906248-1|AAX60594.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906247-1|AAX60593.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906246-1|AAX60592.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906245-1|AAX60591.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906244-1|AAX60590.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906243-1|AAX60589.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906242-1|AAX60588.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906241-1|AAX60587.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906240-1|AAX60586.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906239-1|AAX60585.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906238-1|AAX60584.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906237-1|AAX60583.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906236-1|AAX60582.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906235-1|AAX60581.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906234-1|AAX60580.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906233-1|AAX60579.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906232-1|AAX60578.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906231-1|AAX60577.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906230-1|AAX60576.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906229-1|AAX60575.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906228-1|AAX60574.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906227-1|AAX60573.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906226-1|AAX60572.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906225-1|AAX60571.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906224-1|AAX60570.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906223-1|AAX60569.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906222-1|AAX60568.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906221-1|AAX60567.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906220-1|AAX60566.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906219-1|AAX60565.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906218-1|AAX60564.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906217-1|AAX60563.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906216-1|AAX60562.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906215-1|AAX60561.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906214-1|AAX60560.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906213-1|AAX60559.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906212-1|AAX60558.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906211-1|AAX60557.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906210-1|AAX60556.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906209-1|AAX60555.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906208-1|AAX60554.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906207-1|AAX60553.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906206-1|AAX60552.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906205-1|AAX60551.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906204-1|AAX60550.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906203-1|AAX60549.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906202-1|AAX60548.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906201-1|AAX60547.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906200-1|AAX60546.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906199-1|AAX60545.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906198-1|AAX60544.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906197-1|AAX60543.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906196-1|AAX60542.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906195-1|AAX60541.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906194-1|AAX60540.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906193-1|AAX60539.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906192-1|AAX60538.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906191-1|AAX60537.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906190-1|AAX60536.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906189-1|AAX60535.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906188-1|AAX60534.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906187-1|AAX60533.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906186-1|AAX60532.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906185-1|AAX60531.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906184-1|AAX60530.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906183-1|AAX60529.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906182-1|AAX60528.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906181-1|AAX60527.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906180-1|AAX60526.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906179-1|AAX60525.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906178-1|AAX60524.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906177-1|AAX60523.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906176-1|AAX60522.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906175-1|AAX60521.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906174-1|AAX60520.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906173-1|AAX60519.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906172-1|AAX60518.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906171-1|AAX60517.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906170-1|AAX60516.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906169-1|AAX60515.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906168-1|AAX60514.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906167-1|AAX60513.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906166-1|AAX60512.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906165-1|AAX60511.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906164-1|AAX60510.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906163-1|AAX60509.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906162-1|AAX60508.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906161-1|AAX60507.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906160-1|AAX60506.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906159-1|AAX60505.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906158-1|AAX60504.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906157-1|AAX60503.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906156-1|AAX60502.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906155-1|AAX60501.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906154-1|AAX60500.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906153-1|AAX60499.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906152-1|AAX60498.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906151-1|AAX60497.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906150-1|AAX60496.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906149-1|AAX60495.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906148-1|AAX60494.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906147-1|AAX60493.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906146-1|AAX60492.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906145-1|AAX60491.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906144-1|AAX60490.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906143-1|AAX60489.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906142-1|AAX60488.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906141-1|AAX60487.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906140-1|AAX60486.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906139-1|AAX60485.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906138-1|AAX60484.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906137-1|AAX60483.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906136-1|AAX60482.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906135-1|AAX60481.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906134-1|AAX60480.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906133-1|AAX60479.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906132-1|AAX60478.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906131-1|AAX60477.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906130-1|AAX60476.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906129-1|AAX60475.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906128-1|AAX60474.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906127-1|AAX60473.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906126-1|AAX60472.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906125-1|AAX60471.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906124-1|AAX60470.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906123-1|AAX60469.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906122-1|AAX60468.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906121-1|AAX60467.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906120-1|AAX60466.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906119-1|AAX60465.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906118-1|AAX60464.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906117-1|AAX60463.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906116-1|AAX60462.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906115-1|AAX60461.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906114-1|AAX60460.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906113-1|AAX60459.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906112-1|AAX60458.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906111-1|AAX60457.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906110-1|AAX60456.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906109-1|AAX60455.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906108-1|AAX60454.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906107-1|AAX60453.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906106-1|AAX60452.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906105-1|AAX60451.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906104-1|AAX60450.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906103-1|AAX60449.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906102-1|AAX60448.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906101-1|AAX60447.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906100-1|AAX60446.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906099-1|AAX60445.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906098-1|AAX60444.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906096-1|AAX60442.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906095-1|AAX60441.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906094-1|AAX60440.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906093-1|AAX60439.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906092-1|AAX60438.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906091-1|AAX60437.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906090-1|AAX60436.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906089-1|AAX60435.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906088-1|AAX60434.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906087-1|AAX60433.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906086-1|AAX60432.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906085-1|AAX60431.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906084-1|AAX60430.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906083-1|AAX60429.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906082-1|AAX60428.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906081-1|AAX60427.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906080-1|AAX60426.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906079-1|AAX60425.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906078-1|AAX60424.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906077-1|AAX60423.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906076-1|AAX60422.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906075-1|AAX60421.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906074-1|AAX60420.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906073-1|AAX60419.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906072-1|AAX60418.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906071-1|AAX60417.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906070-1|AAX60416.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906069-1|AAX60415.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906068-1|AAX60414.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906067-1|AAX60413.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906066-1|AAX60412.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906065-1|AAX60411.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906064-1|AAX60410.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906063-1|AAX60409.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906062-1|AAX60408.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906061-1|AAX60407.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906060-1|AAX60406.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906059-1|AAX60405.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906058-1|AAX60404.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906057-1|AAX60403.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906056-1|AAX60402.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906055-1|AAX60401.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906054-1|AAX60400.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906053-1|AAX60399.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906052-1|AAX60398.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906051-1|AAX60397.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906050-1|AAX60396.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906049-1|AAX60395.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906048-1|AAX60394.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906047-1|AAX60393.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906046-1|AAX60392.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906045-1|AAX60391.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906044-1|AAX60390.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906043-1|AAX60389.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906042-1|AAX60388.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906041-1|AAX60387.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906040-1|AAX60386.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906039-1|AAX60385.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906038-1|AAX60384.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906037-1|AAX60383.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906036-1|AAX60382.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906035-1|AAX60381.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906034-1|AAX60380.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906033-1|AAX60379.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906032-1|AAX60378.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906031-1|AAX60377.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906030-1|AAX60376.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906029-1|AAX60375.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906028-1|AAX60374.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906027-1|AAX60373.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906026-1|AAX60372.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906025-1|AAX60371.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906024-1|AAX60370.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906023-1|AAX60369.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906022-1|AAX60368.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906021-1|AAX60367.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906020-1|AAX60366.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906019-1|AAX60365.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906018-1|AAX60364.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906017-1|AAX60363.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906016-1|AAX60362.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906015-1|AAX60361.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906014-1|AAX60360.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906013-1|AAX60359.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906012-1|AAX60358.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906011-1|AAX60357.1| 55|Drosophila melanogaster enhancer of ... 29 3.0 AY906010-1|AAX60356.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906009-1|AAX60355.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906008-1|AAX60354.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906007-1|AAX60353.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906006-1|AAX60352.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906005-1|AAX60351.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906004-1|AAX60350.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906003-1|AAX60349.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906002-1|AAX60348.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906001-1|AAX60347.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY906000-1|AAX60346.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905999-1|AAX60345.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905998-1|AAX60344.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905997-1|AAX60343.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905996-1|AAX60342.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905995-1|AAX60341.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905994-1|AAX60340.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905993-1|AAX60339.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905992-1|AAX60338.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905991-1|AAX60337.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905990-1|AAX60336.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905989-1|AAX60335.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905988-1|AAX60334.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905987-1|AAX60333.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905986-1|AAX60332.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905985-1|AAX60331.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905984-1|AAX60330.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905983-1|AAX60329.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905982-1|AAX60328.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905981-1|AAX60327.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905980-1|AAX60326.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905979-1|AAX60325.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905978-1|AAX60324.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905976-1|AAX60322.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905975-1|AAX60321.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905974-1|AAX60320.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905973-1|AAX60319.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905972-1|AAX60318.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905971-1|AAX60317.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905970-1|AAX60316.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905969-1|AAX60315.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905968-1|AAX60314.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905967-1|AAX60313.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905966-1|AAX60312.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905965-1|AAX60311.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905964-1|AAX60310.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905963-1|AAX60309.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905962-1|AAX60308.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905961-1|AAX60307.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905960-1|AAX60306.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905959-1|AAX60305.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905958-1|AAX60304.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905957-1|AAX60303.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905956-1|AAX60302.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905955-1|AAX60301.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905954-1|AAX60300.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905953-1|AAX60299.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905952-1|AAX60298.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905951-1|AAX60297.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905950-1|AAX60296.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905949-1|AAX60295.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905948-1|AAX60294.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905947-1|AAX60293.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905946-1|AAX60292.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905945-1|AAX60291.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905944-1|AAX60290.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905943-1|AAX60289.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905942-1|AAX60288.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905941-1|AAX60287.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905940-1|AAX60286.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905939-1|AAX60285.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905938-1|AAX60284.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905937-1|AAX60283.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905936-1|AAX60282.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905935-1|AAX60281.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905934-1|AAX60280.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905933-1|AAX60279.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905932-1|AAX60278.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905931-1|AAX60277.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905930-1|AAX60276.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905929-1|AAX60275.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905928-1|AAX60274.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905927-1|AAX60273.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905926-1|AAX60272.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905925-1|AAX60271.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905924-1|AAX60270.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905923-1|AAX60269.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905922-1|AAX60268.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905921-1|AAX60267.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905920-1|AAX60266.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905919-1|AAX60265.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905918-1|AAX60264.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905917-1|AAX60263.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905916-1|AAX60262.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905915-1|AAX60261.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905914-1|AAX60260.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905913-1|AAX60259.1| 69|Drosophila melanogaster enhancer of ... 29 3.0 AY905912-1|AAX60258.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905911-1|AAX60257.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905910-1|AAX60256.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905909-1|AAX60255.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905908-1|AAX60254.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905907-1|AAX60253.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905906-1|AAX60252.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905905-1|AAX60251.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905904-1|AAX60250.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905903-1|AAX60249.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905902-1|AAX60248.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905901-1|AAX60247.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY905900-1|AAX60246.1| 70|Drosophila melanogaster enhancer of ... 29 3.0 AY779921-5|AAV59233.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779920-5|AAV59221.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779919-5|AAV59209.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779918-5|AAV59197.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779917-5|AAV59185.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779916-5|AAV59173.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779915-5|AAV59161.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779914-5|AAV59149.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779913-5|AAV59137.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779912-5|AAV59125.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779911-5|AAV59113.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779910-5|AAV59101.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779909-5|AAV59089.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779908-5|AAV59077.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779907-5|AAV59065.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY779906-5|AAV59053.1| 156|Drosophila melanogaster enhancer of ... 29 3.0 AY113480-1|AAM29485.1| 156|Drosophila melanogaster RE44854p pro... 29 3.0 AJ010167-1|CAB39163.1| 156|Drosophila melanogaster M1 protein p... 29 3.0 AE014297-3896|AAF56548.1| 156|Drosophila melanogaster CG8342-PA... 29 3.0 >X94613-1|CAA64319.1| 190|Drosophila melanogaster ribosomal protein L9 protein. Length = 190 Score = 133 bits (321), Expect = 1e-31 Identities = 64/76 (84%), Positives = 69/76 (90%) Frame = -1 Query: 260 VTTEGNTIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIEGNSLEDVPSSAALIQQ 81 VT+E NT+IEIRNFLGEKYIRRV+MAPGVTVVNS QKDELI+EGN +E V SAALIQQ Sbjct: 102 VTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQ 161 Query: 80 STTVKNKDIRKFLDGL 33 STTVKNKDIRKFLDGL Sbjct: 162 STTVKNKDIRKFLDGL 177 >BT022718-1|AAY55134.1| 190|Drosophila melanogaster RE74350p protein. Length = 190 Score = 133 bits (321), Expect = 1e-31 Identities = 64/76 (84%), Positives = 69/76 (90%) Frame = -1 Query: 260 VTTEGNTIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIEGNSLEDVPSSAALIQQ 81 VT+E NT+IEIRNFLGEKYIRRV+MAPGVTVVNS QKDELI+EGN +E V SAALIQQ Sbjct: 102 VTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQ 161 Query: 80 STTVKNKDIRKFLDGL 33 STTVKNKDIRKFLDGL Sbjct: 162 STTVKNKDIRKFLDGL 177 >AE014134-2010|AAF53049.1| 190|Drosophila melanogaster CG6141-PB, isoform B protein. Length = 190 Score = 133 bits (321), Expect = 1e-31 Identities = 64/76 (84%), Positives = 69/76 (90%) Frame = -1 Query: 260 VTTEGNTIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIEGNSLEDVPSSAALIQQ 81 VT+E NT+IEIRNFLGEKYIRRV+MAPGVTVVNS QKDELI+EGN +E V SAALIQQ Sbjct: 102 VTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQ 161 Query: 80 STTVKNKDIRKFLDGL 33 STTVKNKDIRKFLDGL Sbjct: 162 STTVKNKDIRKFLDGL 177 >AE014134-2009|AAF53048.2| 190|Drosophila melanogaster CG6141-PA, isoform A protein. Length = 190 Score = 133 bits (321), Expect = 1e-31 Identities = 64/76 (84%), Positives = 69/76 (90%) Frame = -1 Query: 260 VTTEGNTIIEIRNFLGEKYIRRVKMAPGVTVVNSPKQKDELIIEGNSLEDVPSSAALIQQ 81 VT+E NT+IEIRNFLGEKYIRRV+MAPGVTVVNS QKDELI+EGN +E V SAALIQQ Sbjct: 102 VTSENNTVIEIRNFLGEKYIRRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQ 161 Query: 80 STTVKNKDIRKFLDGL 33 STTVKNKDIRKFLDGL Sbjct: 162 STTVKNKDIRKFLDGL 177 >BT023691-1|AAY85091.1| 68|Drosophila melanogaster IP03664p protein. Length = 68 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 398 CICGKIYSPVCGSDGKTYEN 457 C C + Y PVCGSD TY N Sbjct: 27 CPCPRNYDPVCGSDSVTYSN 46 >AE014134-2103|AAN10787.1| 68|Drosophila melanogaster CG31704-PA protein. Length = 68 Score = 32.7 bits (71), Expect = 0.24 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +2 Query: 398 CICGKIYSPVCGSDGKTYEN 457 C C + Y PVCGSD TY N Sbjct: 27 CPCPRNYDPVCGSDSVTYSN 46 >AE014134-2104|AAN10788.1| 79|Drosophila melanogaster CG31758-PA protein. Length = 79 Score = 32.3 bits (70), Expect = 0.32 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 392 PLCICGKIYSPVCGSDGKTYEN 457 P+C C + Y PVCGS+ TY N Sbjct: 32 PICPCPRNYEPVCGSNLVTYPN 53 >AY058325-1|AAL13554.1| 662|Drosophila melanogaster GH09510p protein. Length = 662 Score = 31.9 bits (69), Expect = 0.43 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 401 ICGKIYSPVCGSDGKTYEN 457 IC + + PVCGSD KTY N Sbjct: 609 ICPREFEPVCGSDNKTYLN 627 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYEN 457 C PVCG+DG+TY N Sbjct: 225 CSTEKDPVCGTDGRTYLN 242 >AE014296-1453|AAF50418.2| 662|Drosophila melanogaster CG32354-PA protein. Length = 662 Score = 31.9 bits (69), Expect = 0.43 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +2 Query: 401 ICGKIYSPVCGSDGKTYEN 457 IC + + PVCGSD KTY N Sbjct: 609 ICPREFEPVCGSDNKTYLN 627 Score = 27.9 bits (59), Expect = 6.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYEN 457 C PVCG+DG+TY N Sbjct: 225 CSTEKDPVCGTDGRTYLN 242 >AY052138-1|AAK93562.1| 1071|Drosophila melanogaster SD09502p protein. Length = 1071 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 398 CICGKIYSPVCGSDGKTY 451 C C Y PVCGS+G TY Sbjct: 727 CNCPAHYVPVCGSNGNTY 744 >AE014296-2453|AAF49684.2| 1071|Drosophila melanogaster CG5392-PA protein. Length = 1071 Score = 29.5 bits (63), Expect = 2.3 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 398 CICGKIYSPVCGSDGKTY 451 C C Y PVCGS+G TY Sbjct: 727 CNCPAHYVPVCGSNGNTY 744 >AY906258-1|AAX60604.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906257-1|AAX60603.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906256-1|AAX60602.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906255-1|AAX60601.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906254-1|AAX60600.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906253-1|AAX60599.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906252-1|AAX60598.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906251-1|AAX60597.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906250-1|AAX60596.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906249-1|AAX60595.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906248-1|AAX60594.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906247-1|AAX60593.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906246-1|AAX60592.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906245-1|AAX60591.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906244-1|AAX60590.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906243-1|AAX60589.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906242-1|AAX60588.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906241-1|AAX60587.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906240-1|AAX60586.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906239-1|AAX60585.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906238-1|AAX60584.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906237-1|AAX60583.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906236-1|AAX60582.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906235-1|AAX60581.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906234-1|AAX60580.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906233-1|AAX60579.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906232-1|AAX60578.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906231-1|AAX60577.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906230-1|AAX60576.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906229-1|AAX60575.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906228-1|AAX60574.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906227-1|AAX60573.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906226-1|AAX60572.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906225-1|AAX60571.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906224-1|AAX60570.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906223-1|AAX60569.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906222-1|AAX60568.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906221-1|AAX60567.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906220-1|AAX60566.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906219-1|AAX60565.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906218-1|AAX60564.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906217-1|AAX60563.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906216-1|AAX60562.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906215-1|AAX60561.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906214-1|AAX60560.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906213-1|AAX60559.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906212-1|AAX60558.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906211-1|AAX60557.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906210-1|AAX60556.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906209-1|AAX60555.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906208-1|AAX60554.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906207-1|AAX60553.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906206-1|AAX60552.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906205-1|AAX60551.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906204-1|AAX60550.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906203-1|AAX60549.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906202-1|AAX60548.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906201-1|AAX60547.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906200-1|AAX60546.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906199-1|AAX60545.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906198-1|AAX60544.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906197-1|AAX60543.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906196-1|AAX60542.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906195-1|AAX60541.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906194-1|AAX60540.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906193-1|AAX60539.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906192-1|AAX60538.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906191-1|AAX60537.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906190-1|AAX60536.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906189-1|AAX60535.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906188-1|AAX60534.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906187-1|AAX60533.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906186-1|AAX60532.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906185-1|AAX60531.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906184-1|AAX60530.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906183-1|AAX60529.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906182-1|AAX60528.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906181-1|AAX60527.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906180-1|AAX60526.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906179-1|AAX60525.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906178-1|AAX60524.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906177-1|AAX60523.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906176-1|AAX60522.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906175-1|AAX60521.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906174-1|AAX60520.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906173-1|AAX60519.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906172-1|AAX60518.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906171-1|AAX60517.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906170-1|AAX60516.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906169-1|AAX60515.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906168-1|AAX60514.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906167-1|AAX60513.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906166-1|AAX60512.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906165-1|AAX60511.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906164-1|AAX60510.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906163-1|AAX60509.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906162-1|AAX60508.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906161-1|AAX60507.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906160-1|AAX60506.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906159-1|AAX60505.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906158-1|AAX60504.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906157-1|AAX60503.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906156-1|AAX60502.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906155-1|AAX60501.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906154-1|AAX60500.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906153-1|AAX60499.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906152-1|AAX60498.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906151-1|AAX60497.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906150-1|AAX60496.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906149-1|AAX60495.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906148-1|AAX60494.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906147-1|AAX60493.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906146-1|AAX60492.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906145-1|AAX60491.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906144-1|AAX60490.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906143-1|AAX60489.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906142-1|AAX60488.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906141-1|AAX60487.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906140-1|AAX60486.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906139-1|AAX60485.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906138-1|AAX60484.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906137-1|AAX60483.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906136-1|AAX60482.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906135-1|AAX60481.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906134-1|AAX60480.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906133-1|AAX60479.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906132-1|AAX60478.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906131-1|AAX60477.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906130-1|AAX60476.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906129-1|AAX60475.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906128-1|AAX60474.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906127-1|AAX60473.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906126-1|AAX60472.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906125-1|AAX60471.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906124-1|AAX60470.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906123-1|AAX60469.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906122-1|AAX60468.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906121-1|AAX60467.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906120-1|AAX60466.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906119-1|AAX60465.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906118-1|AAX60464.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906117-1|AAX60463.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906116-1|AAX60462.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906115-1|AAX60461.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906114-1|AAX60460.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906113-1|AAX60459.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906112-1|AAX60458.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906111-1|AAX60457.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906110-1|AAX60456.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906109-1|AAX60455.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906108-1|AAX60454.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906107-1|AAX60453.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906106-1|AAX60452.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906105-1|AAX60451.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906104-1|AAX60450.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906103-1|AAX60449.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906102-1|AAX60448.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906101-1|AAX60447.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906100-1|AAX60446.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906099-1|AAX60445.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906098-1|AAX60444.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906096-1|AAX60442.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906095-1|AAX60441.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906094-1|AAX60440.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906093-1|AAX60439.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906092-1|AAX60438.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906091-1|AAX60437.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906090-1|AAX60436.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906089-1|AAX60435.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906088-1|AAX60434.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906087-1|AAX60433.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906086-1|AAX60432.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906085-1|AAX60431.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906084-1|AAX60430.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906083-1|AAX60429.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906082-1|AAX60428.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906081-1|AAX60427.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906080-1|AAX60426.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906079-1|AAX60425.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906078-1|AAX60424.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906077-1|AAX60423.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906076-1|AAX60422.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906075-1|AAX60421.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906074-1|AAX60420.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906073-1|AAX60419.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906072-1|AAX60418.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906071-1|AAX60417.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906070-1|AAX60416.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906069-1|AAX60415.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906068-1|AAX60414.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906067-1|AAX60413.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906066-1|AAX60412.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906065-1|AAX60411.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906064-1|AAX60410.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906063-1|AAX60409.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906062-1|AAX60408.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906061-1|AAX60407.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906060-1|AAX60406.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906059-1|AAX60405.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906058-1|AAX60404.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906057-1|AAX60403.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906056-1|AAX60402.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906055-1|AAX60401.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906054-1|AAX60400.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906053-1|AAX60399.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906052-1|AAX60398.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906051-1|AAX60397.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906050-1|AAX60396.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906049-1|AAX60395.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906048-1|AAX60394.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906047-1|AAX60393.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906046-1|AAX60392.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906045-1|AAX60391.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906044-1|AAX60390.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906043-1|AAX60389.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906042-1|AAX60388.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906041-1|AAX60387.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906040-1|AAX60386.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906039-1|AAX60385.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906038-1|AAX60384.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906037-1|AAX60383.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906036-1|AAX60382.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906035-1|AAX60381.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906034-1|AAX60380.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906033-1|AAX60379.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906032-1|AAX60378.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906031-1|AAX60377.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906030-1|AAX60376.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906029-1|AAX60375.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906028-1|AAX60374.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906027-1|AAX60373.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906026-1|AAX60372.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906025-1|AAX60371.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906024-1|AAX60370.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906023-1|AAX60369.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906022-1|AAX60368.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906021-1|AAX60367.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906020-1|AAX60366.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 >AY906019-1|AAX60365.1| 70|Drosophila melanogaster enhancer of split m1 protein protein. Length = 70 Score = 29.1 bits (62), Expect = 3.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 404 CGKIYSPVCGSDGKTYE 454 C IY PVCG+DG+ ++ Sbjct: 33 CPSIYKPVCGTDGQNFK 49 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,145,053 Number of Sequences: 53049 Number of extensions: 429928 Number of successful extensions: 2042 Number of sequences better than 10.0: 387 Number of HSP's better than 10.0 without gapping: 1969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2042 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1518217281 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -