BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M06 (420 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81077-17|CAB82212.1| 2944|Caenorhabditis elegans Hypothetical p... 27 5.5 Z75952-7|CAB82204.1| 2944|Caenorhabditis elegans Hypothetical pr... 27 5.5 AF016673-5|AAB66123.1| 684|Caenorhabditis elegans Hypothetical ... 26 9.5 AF002196-6|AAB53978.2| 406|Caenorhabditis elegans Hypothetical ... 26 9.5 >Z81077-17|CAB82212.1| 2944|Caenorhabditis elegans Hypothetical protein F36A2.13 protein. Length = 2944 Score = 27.1 bits (57), Expect = 5.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 106 NTQTASYKSDEKNFCQLKGILCSVP 180 +T T+ + +DEK ++ GI+C +P Sbjct: 2566 HTMTSGFLTDEKTIGRVMGIMCQLP 2590 >Z75952-7|CAB82204.1| 2944|Caenorhabditis elegans Hypothetical protein F36A2.13 protein. Length = 2944 Score = 27.1 bits (57), Expect = 5.5 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +1 Query: 106 NTQTASYKSDEKNFCQLKGILCSVP 180 +T T+ + +DEK ++ GI+C +P Sbjct: 2566 HTMTSGFLTDEKTIGRVMGIMCQLP 2590 >AF016673-5|AAB66123.1| 684|Caenorhabditis elegans Hypothetical protein T06D4.4 protein. Length = 684 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +2 Query: 257 ACIAVQMIFCVLPIKLRLLFYILLYVFVCRD 349 A I ++I CV P+ L +LF++LL++ +D Sbjct: 27 ANIKDRIINCVYPVILIILFWLLLFIGARQD 57 >AF002196-6|AAB53978.2| 406|Caenorhabditis elegans Hypothetical protein C09D4.3 protein. Length = 406 Score = 26.2 bits (55), Expect = 9.5 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 105 KYSNGKLQIR*KKLLSIKRH 164 KYS G L + K LLSI+RH Sbjct: 118 KYSTGMLPMEIKVLLSIRRH 137 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,747,396 Number of Sequences: 27780 Number of extensions: 137312 Number of successful extensions: 299 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 297 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 299 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -