BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M05 (591 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24230.1 68418.m02851 expressed protein 32 0.25 At4g03260.1 68417.m00445 leucine-rich repeat family protein cont... 32 0.25 At4g10050.1 68417.m01643 hydrolase, alpha/beta fold family prote... 31 0.57 At5g67040.1 68418.m08452 hypothetical protein contains Pfam prof... 30 1.3 At1g10040.1 68414.m01132 expressed protein non-consensus GC dono... 30 1.3 At5g65960.1 68418.m08303 expressed protein 29 3.1 At4g00230.1 68417.m00025 subtilisin-like serine endopeptidase (X... 29 3.1 At5g24220.1 68418.m02850 lipase class 3-related 28 5.4 At4g10550.1 68417.m01727 subtilase family protein contains simil... 28 5.4 At4g10260.1 68417.m01684 pfkB-type carbohydrate kinase family pr... 28 5.4 At5g59400.2 68418.m07444 expressed protein predicted protein, Ar... 27 7.1 At5g59400.1 68418.m07443 expressed protein predicted protein, Ar... 27 7.1 At4g10955.1 68417.m01782 lipase class 3 family protein contains ... 27 7.1 At1g26120.1 68414.m03188 esterase-related contains similaity to ... 27 7.1 At5g51270.1 68418.m06356 protein kinase family protein contains ... 27 9.4 At4g00570.1 68417.m00080 malate oxidoreductase, putative similar... 27 9.4 At2g34500.1 68415.m04237 cytochrome P450 family protein similar ... 27 9.4 At1g68960.1 68414.m07893 hypothetical protein contains Pfam prof... 27 9.4 At1g06520.1 68414.m00691 phospholipid/glycerol acyltransferase f... 27 9.4 At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transfera... 27 9.4 >At5g24230.1 68418.m02851 expressed protein Length = 369 Score = 32.3 bits (70), Expect = 0.25 Identities = 29/87 (33%), Positives = 45/87 (51%) Frame = +1 Query: 253 LHSTTYVRFIGEKLGEVLAAMAKGGMSPDAIHLIGHSLGSHISGFAGKTFTTLTGLQVGR 432 LH +T RF+ + + +A+AK G + A+ L GHSLG+ ++ AGK T +G + Sbjct: 149 LHDST--RFV-HAIQVIQSAVAKTGNA--AVWLAGHSLGAAVALLAGKIMTR-SGFPLES 202 Query: 433 ISGLDPAGPCFSNIPAELRLKHTDAKY 513 P FS+IP E +K K+ Sbjct: 203 YL----FNPPFSSIPIEKLVKSEKLKH 225 >At4g03260.1 68417.m00445 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 677 Score = 32.3 bits (70), Expect = 0.25 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = -1 Query: 258 MEVQPTDERAAVQGQDVKFTLV*ETIADDIEVLLSRIVGEAVNEDDQLPMRVVI 97 +E + T+++A G+D KF + + + D V LS E DD+LP V+ Sbjct: 312 LEGETTNQQAEFSGKDSKFKRIEDWVNDLQHVNLSEEADEITGYDDELPREPVV 365 >At4g10050.1 68417.m01643 hydrolase, alpha/beta fold family protein similar to protein phosphatase methylesterase-1 [Homo sapiens] GI:5533003; contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 350 Score = 31.1 bits (67), Expect = 0.57 Identities = 20/46 (43%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Frame = +1 Query: 298 EVLAAMAK-GGMSPDAIHLIGHSLGSHIS--GFAGKTFTTLTGLQV 426 +VLA + + G SP AI L+GHS+G ++ A KT +L GL V Sbjct: 134 DVLAVIKELYGDSPPAIVLVGHSMGGSVAVQVAANKTLPSLAGLVV 179 >At5g67040.1 68418.m08452 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 165 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 277 FIGEKLGEVLAAMAKGGMSPDAIHLIGHSLGSH 375 F+G L A G+ P++I+ IGH LGS+ Sbjct: 104 FLGASEAFCLTASMYPGLKPNSIYYIGHGLGSY 136 >At1g10040.1 68414.m01132 expressed protein non-consensus GC donor splice site at exon boundary 21576 Length = 412 Score = 29.9 bits (64), Expect = 1.3 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +1 Query: 256 HST-TY--VRFIGEKLGEVLAAMAKGGMSPDAIHLIGHSLGSHISGFA 390 HST T+ V +GE+L E + ++ K S I +GHSLG I+ +A Sbjct: 120 HSTQTFDGVDVMGERLAEEVRSVIKRHPSLQKISFVGHSLGGLIARYA 167 >At5g65960.1 68418.m08303 expressed protein Length = 393 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/67 (28%), Positives = 31/67 (46%) Frame = -1 Query: 423 LKSGKRCERLTSET*YVRAEAVPYQMNRIGTHTALCHSREDFTELLSYEPNVRGRMEVQP 244 L SG R E L ++T A+ +GT C+ ED +L+S N+R + + P Sbjct: 309 LPSGSRLE-LQNDT----DRAIVTDEKPLGTENEKCYEFEDVEQLMSEIGNIRDNLRLMP 363 Query: 243 TDERAAV 223 +R + Sbjct: 364 DFQRREI 370 >At4g00230.1 68417.m00025 subtilisin-like serine endopeptidase (XSP1) identical to subtilisin-type serine endopeptidase XSP1 GI:6708179 from [Arabidopsis thaliana] Length = 749 Score = 28.7 bits (61), Expect = 3.1 Identities = 23/94 (24%), Positives = 41/94 (43%), Gaps = 9/94 (9%) Frame = +1 Query: 298 EVLAAMAKGGMSPDAIHLIGHSLGSHISGFAG-----KTFT----TLTGLQVGRISGLDP 450 +V+ + G++PD+ + H LG + + G K FT + G + + G P Sbjct: 138 DVIIGVLDTGITPDSESFLDHGLGPPPAKWKGSCGPYKNFTGCNNKIIGAKYFKHDGNVP 197 Query: 451 AGPCFSNIPAELRLKHTDAKYVDVIHTDGGVYGL 552 AG S I + HT + V+ + +YG+ Sbjct: 198 AGEVRSPIDIDGHGTHTSSTVAGVLVANASLYGI 231 >At5g24220.1 68418.m02850 lipase class 3-related Length = 376 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = +1 Query: 331 SPDAIHLIGHSLGSHISGFAGKTFTT 408 S AI L GHSLG+ + AGKT T+ Sbjct: 171 SEAAIWLAGHSLGAALVLLAGKTMTS 196 >At4g10550.1 68417.m01727 subtilase family protein contains similarity to subtilisin-like protease AIR3 GI:4218991 from [Arabidopsis thaliana] Length = 778 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = +1 Query: 280 IGEKLGEVLAAMAKGGMSPDAIHLIGHSLGSH-ISGFAGKTFTTLTGLQVGRISGLDPAG 456 +G+ +G +A + G + A ++ + + +S A T TT + +SG A Sbjct: 500 VGQPVGTKVATFSSRGPNSIAPAILKPDIAAPGVSILAATTNTTFSDQGFIMLSGTSMAA 559 Query: 457 PCFSNIPAELRLKHTD 504 P S + A L+ H D Sbjct: 560 PAISGVAALLKALHRD 575 >At4g10260.1 68417.m01684 pfkB-type carbohydrate kinase family protein contains Pfam profile: PF00294 pfkB family carbohydrate kinase Length = 324 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = -1 Query: 330 HTALCHSREDFTELLSYEPNVRGRMEVQPTDERAAVQG 217 H A + +D LLSY+PNV R+ + P+ E AA++G Sbjct: 150 HMAAMKTAKDAGVLLSYDPNV--RLPLWPSTE-AAIEG 184 >At5g59400.2 68418.m07444 expressed protein predicted protein, Arabidopsis thaliana Length = 301 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +2 Query: 248 CTSIRPRTFGS*ERSSVKSSRLWQRA 325 CTSIRPR GS S V+ SRL RA Sbjct: 5 CTSIRPRLIGS--SSIVELSRLINRA 28 >At5g59400.1 68418.m07443 expressed protein predicted protein, Arabidopsis thaliana Length = 299 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = +2 Query: 248 CTSIRPRTFGS*ERSSVKSSRLWQRA 325 CTSIRPR GS S V+ SRL RA Sbjct: 5 CTSIRPRLIGS--SSIVELSRLINRA 28 >At4g10955.1 68417.m01782 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 350 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = +1 Query: 253 LHSTTYVRFIGEKLGEVLAAMAKGGMSPDAIHLIGHSLGSHISGFAGKT 399 LH+TT + + ++A++ GG S + L GHSLG+ ++ GKT Sbjct: 136 LHTTTRFEIAIQAVRNIVASV--GGSS---VWLAGHSLGASMALLTGKT 179 >At1g26120.1 68414.m03188 esterase-related contains similaity to esterase 6 GI:606998 from [Drosophila simulans] and esterase GI:12584120 from [Sphingomonas elodea] Length = 476 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 313 MAKGGMSPDAIHLIGHSLGSHIS 381 +A+ G PD I+L+G S G+HI+ Sbjct: 270 IAEYGGDPDRIYLMGQSAGAHIA 292 >At5g51270.1 68418.m06356 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 819 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/60 (25%), Positives = 30/60 (50%) Frame = +3 Query: 273 SVHRREAR*SPRGYGKGRYESRCDSSDRAQPRLSHIRFRW*DVHNAYRTSSRQDIRTGSG 452 + RREA + + + + + + S P+L + F W ++ NA +S +D++ G G Sbjct: 413 AAQRREAE--MKATHEAKEKEKLEESSLVAPKLQYQEFTWEEIINA-TSSFSEDLKIGMG 469 >At4g00570.1 68417.m00080 malate oxidoreductase, putative similar to NAD-dependent malic enzyme 59 kDa isoform, mitochondrial precursor (EC 1.1.1.39) (NAD-ME) (SP:P37225) {Solanum tuberosum} Length = 607 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +1 Query: 277 FIGEKLGEVLAAMAKGGMSPDAIHLIGHSLGSHISGFAGKTFTTLT--GLQVGRISGLDP 450 F+ +K+ V A A G++ A+ + G S A K F + GL + LDP Sbjct: 328 FVNQKIVVVGAGSAGLGVTKMAVQAVARMAGISESE-ATKNFYLIDKDGLVTTERTKLDP 386 Query: 451 AGPCFSNIPAELR 489 F+ PAE+R Sbjct: 387 GAVLFAKNPAEIR 399 >At2g34500.1 68415.m04237 cytochrome P450 family protein similar to Cytochrome P450 61 (C-22 sterol desaturase) (SP:P54781) {Saccharomyces cerevisiae} Length = 495 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 334 PDAIHLIGHSLGSHISG 384 PDA HLIGH G + G Sbjct: 101 PDAFHLIGHPFGKKLFG 117 >At1g68960.1 68414.m07893 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 376 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +1 Query: 277 FIGEKLGEVLAAMAKGGMSPDAIHLIGHSLGSHISGFAGKTFTTLT 414 F+GE L+A G++P++++ GH G I A T L+ Sbjct: 313 FLGENESFCLSAKDFPGLNPNSVYFAGHGSGYGIWDLASCTIRYLS 358 >At1g06520.1 68414.m00691 phospholipid/glycerol acyltransferase family protein contains Pfam profile PF01553: Acyltransferase Length = 585 Score = 27.1 bits (57), Expect = 9.4 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = -3 Query: 400 TSYQRNLICESRGCALSDESHRDSY 326 T YQ L+ ++R C++S + +RD++ Sbjct: 82 TKYQELLLDKNRACSVSSDHYRDTF 106 >At1g05670.1 68414.m00588 UDP-glucoronosyl/UDP-glucosyl transferase family protein similar to UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum] GI:7385017; contains Pfam profiles PF00201: UDP-glucoronosyl and UDP-glucosyl transferase, PF01535: PPR repeat Length = 1184 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 91 SRDYDPHRKLIIFIHGFTDDPTKENFNVISNGFLNQGEFNILALDGSSLIRWL 249 S + D ++++ + G PT FNV+ NGF G + DG L+ W+ Sbjct: 982 SGEMDKAQEILKEMLGKGLQPTIVTFNVLMNGFCLHG----MLEDGEKLLNWM 1030 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,861,838 Number of Sequences: 28952 Number of extensions: 286355 Number of successful extensions: 869 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -