BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_M03 (470 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 5.7 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 7.6 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.0 bits (42), Expect = 5.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -2 Query: 349 FLFSHLALSACFNILSEAST 290 FL L + AC N+LSE T Sbjct: 2 FLAIVLVVCACTNVLSEEYT 21 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 20.6 bits (41), Expect = 7.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -2 Query: 310 ILSEASTETRLKPSSTSIMESIPVPQAPSST 218 ILS E ++++++ S P+P S+T Sbjct: 138 ILSNRFGENEEADAASNVISSTPLPPTTSTT 168 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,076 Number of Sequences: 336 Number of extensions: 2452 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -