BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= I10A02NGRL0006_L23 (559 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 3.1 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 22 3.1 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 22 3.1 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 9.5 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 21 9.5 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 21 9.5 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 161 QIMRIVALQISRYVRRKRPALGQFTGLLG 247 Q+M+ AL + PA+G TG G Sbjct: 267 QVMKYAALATENFSSLLEPAVGTMTGAGG 295 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 391 SGSYPLFCLLRLLDGICTRHPS 326 SG Y ++CLL LL I + S Sbjct: 278 SGMYSMYCLLILLTTIVASYGS 299 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 391 SGSYPLFCLLRLLDGICTRHPS 326 SG Y ++CLL LL I + S Sbjct: 278 SGMYSMYCLLILLTTIVASYGS 299 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = +1 Query: 196 ICAPQTPCAWSVYR 237 IC P T C+W+ R Sbjct: 142 ICYPLTYCSWTSRR 155 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = -2 Query: 441 TSDVIIFRGTLAFMRACLEAIRCFVFFDCWT 349 T + F G + I VFF CWT Sbjct: 259 TRSSLAFLGKAKVRTLKMTIIIVLVFFVCWT 289 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = -2 Query: 441 TSDVIIFRGTLAFMRACLEAIRCFVFFDCWT 349 T + F G + I VFF CWT Sbjct: 259 TRSSLAFLGKAKVRTLKMTIIIVLVFFVCWT 289 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,733 Number of Sequences: 336 Number of extensions: 3079 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -